Ecoer Logo

@azeemgru

25

i am a content writer,

steemit.com/@azeemgru
VOTING POWER100.00%
DOWNVOTE POWER100.00%
RESOURCE CREDITS85.35%
REPUTATION PROGRESS0.00%
Net Worth
0.000USD
STEEM
0.001STEEM
SBD
0.000SBD
Effective Power
10.711SP
├── Own SP
0.000SP
└── Incoming Deleg
+10.711SP

Detailed Balance

STEEM
balance
0.001STEEM
market_balance
0.000STEEM
savings_balance
0.000STEEM
reward_steem_balance
0.000STEEM
STEEM POWER
Own SP
0.000SP
Delegated Out
0.000SP
Delegation In
10.711SP
Effective Power
10.711SP
Reward SP (pending)
0.000SP
SBD
sbd_balance
0.000SBD
sbd_conversions
0.000SBD
sbd_market_balance
0.000SBD
savings_sbd_balance
0.000SBD
reward_sbd_balance
0.000SBD
{
  "balance": "0.001 STEEM",
  "savings_balance": "0.000 STEEM",
  "reward_steem_balance": "0.000 STEEM",
  "vesting_shares": "0.000000 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "17419.000000 VESTS",
  "sbd_balance": "0.000 SBD",
  "savings_sbd_balance": "0.000 SBD",
  "reward_sbd_balance": "0.000 SBD",
  "conversions": []
}

Account Info

nameazeemgru
id1961886
rank126,789
reputation642739783
created2026-05-30T05:11:42
recovery_accountsteemcurator01
proxyNone
post_count26
comment_count0
lifetime_vote_count0
witnesses_voted_for1
last_post2026-06-07T14:54:15
last_root_post2026-06-07T12:39:00
last_vote_time2026-06-05T13:46:42
proxied_vsf_votes0, 0, 0, 0
can_vote1
voting_power9,800
delayed_votes0
balance0.001 STEEM
savings_balance0.000 STEEM
sbd_balance0.000 SBD
savings_sbd_balance0.000 SBD
vesting_shares0.000000 VESTS
delegated_vesting_shares0.000000 VESTS
received_vesting_shares17419.000000 VESTS
reward_vesting_balance0.000000 VESTS
vesting_balance0.000 STEEM
vesting_withdraw_rate0.000000 VESTS
next_vesting_withdrawal1969-12-31T23:59:59
withdrawn0
to_withdraw0
withdraw_routes0
savings_withdraw_requests0
last_account_recovery1970-01-01T00:00:00
reset_accountnull
last_owner_update1970-01-01T00:00:00
last_account_update2026-06-05T16:43:51
minedNo
sbd_seconds0
sbd_last_interest_payment1970-01-01T00:00:00
savings_sbd_last_interest_payment1970-01-01T00:00:00
{
  "active": {
    "account_auths": [],
    "key_auths": [
      [
        "STM4zhs7gBqfU2EvsjFMertqC2iWdedVBazaGG7h5hHhLWWLdaXHc",
        1
      ]
    ],
    "weight_threshold": 1
  },
  "balance": "0.001 STEEM",
  "can_vote": true,
  "comment_count": 0,
  "created": "2026-05-30T05:11:42",
  "curation_rewards": 0,
  "delegated_vesting_shares": "0.000000 VESTS",
  "downvote_manabar": {
    "current_mana": "4354750000",
    "last_update_time": 1780667202
  },
  "guest_bloggers": [],
  "id": 1961886,
  "json_metadata": "{}",
  "last_account_recovery": "1970-01-01T00:00:00",
  "last_account_update": "2026-06-05T16:43:51",
  "last_owner_update": "1970-01-01T00:00:00",
  "last_post": "2026-06-07T14:54:15",
  "last_root_post": "2026-06-07T12:39:00",
  "last_vote_time": "2026-06-05T13:46:42",
  "lifetime_vote_count": 0,
  "market_history": [],
  "memo_key": "STM7v4tK3oHeCDM1C2tvo7QV7oxYZyVoxUDMmfLhcW7fpxEy4PXx9",
  "mined": false,
  "name": "azeemgru",
  "next_vesting_withdrawal": "1969-12-31T23:59:59",
  "other_history": [],
  "owner": {
    "account_auths": [],
    "key_auths": [
      [
        "STM52dbC2FD48nLxceWmARiGTzZQgDCUZA4apRJKZb6wiXDdUDMya",
        1
      ]
    ],
    "weight_threshold": 1
  },
  "pending_claimed_accounts": 0,
  "post_bandwidth": 0,
  "post_count": 26,
  "post_history": [],
  "posting": {
    "account_auths": [],
    "key_auths": [
      [
        "STM7gqZT1H7YFgmnRYPY2jnpGvpFUbxX7KqywNrG2NezD2RFDFf9G",
        1
      ]
    ],
    "weight_threshold": 1
  },
  "posting_json_metadata": "{\"profile\":{\"profile_image\":\"https://cdn.steemitimages.com/DQmSffJ4CLyhWjtK3XxJ1jWvQPjGZzASBymqtjZ8FnUxGr7/ChatGPT%20Image%20Jun%205,%202026,%2001_28_12%20AM.png\",\"cover_image\":\"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png\",\"name\":\"Azeem Sarwar\",\"about\":\"i am a  content writer,\",\"version\":2,\"location\":\"Pakistan\"}}",
  "posting_rewards": 0,
  "proxied_vsf_votes": [
    0,
    0,
    0,
    0
  ],
  "proxy": "",
  "received_vesting_shares": "17419.000000 VESTS",
  "recovery_account": "steemcurator01",
  "reputation": 642739783,
  "reset_account": "null",
  "reward_sbd_balance": "0.000 SBD",
  "reward_steem_balance": "0.000 STEEM",
  "reward_vesting_balance": "0.000000 VESTS",
  "reward_vesting_steem": "0.000 STEEM",
  "savings_balance": "0.000 STEEM",
  "savings_sbd_balance": "0.000 SBD",
  "savings_sbd_last_interest_payment": "1970-01-01T00:00:00",
  "savings_sbd_seconds": "0",
  "savings_sbd_seconds_last_update": "1970-01-01T00:00:00",
  "savings_withdraw_requests": 0,
  "sbd_balance": "0.000 SBD",
  "sbd_last_interest_payment": "1970-01-01T00:00:00",
  "sbd_seconds": "0",
  "sbd_seconds_last_update": "1970-01-01T00:00:00",
  "tags_usage": [],
  "to_withdraw": 0,
  "transfer_history": [],
  "vesting_balance": "0.000 STEEM",
  "vesting_shares": "0.000000 VESTS",
  "vesting_withdraw_rate": "0.000000 VESTS",
  "vote_history": [],
  "voting_manabar": {
    "current_mana": "17070620000",
    "last_update_time": 1780667202
  },
  "voting_power": 9800,
  "withdraw_routes": 0,
  "withdrawn": 0,
  "witness_votes": [
    "bangla.witness"
  ],
  "witnesses_voted_for": 1,
  "rank": 126789
}

Withdraw Routes

IncomingOutgoing
Empty
Empty
{
  "incoming": [],
  "outgoing": []
}
From Date
To Date
olamidexupvoted (100.00%) @azeemgru / tg883t
2026/06/08 02:33:36
authorazeemgru
permlinktg883t
voterolamidex
weight10000 (100.00%)
Transaction InfoBlock #106748607/Trx 2d1ab0fbf26063d3779fb7e94487cfcb13d37958
View Raw JSON Data
{
  "block": 106748607,
  "op": [
    "vote",
    {
      "author": "azeemgru",
      "permlink": "tg883t",
      "voter": "olamidex",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-08T02:33:36",
  "trx_id": "2d1ab0fbf26063d3779fb7e94487cfcb13d37958",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/06/07 14:54:15
authorazeemgru
bodyyes
json metadata{"app":"steemit/0.2"}
parent authorhappycapital
parent permlinkrelatively-the-crypto-market-isn-t-in-an-overbought-zone
permlinktg884f
title
Transaction InfoBlock #106734649/Trx 7e207de6d9aee13ac6e87d07810cd8e6709035e4
View Raw JSON Data
{
  "block": 106734649,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "yes",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "happycapital",
      "parent_permlink": "relatively-the-crypto-market-isn-t-in-an-overbought-zone",
      "permlink": "tg884f",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-07T14:54:15",
  "trx_id": "7e207de6d9aee13ac6e87d07810cd8e6709035e4",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/06/07 14:53:54
authorazeemgru
bodyhello sir,
json metadata{"app":"steemit/0.2"}
parent authoravalanch
parent permlinktg9kwj
permlinktg883t
title
Transaction InfoBlock #106734642/Trx 4006d47d23f14509f15386685afd42a06abb60ce
View Raw JSON Data
{
  "block": 106734642,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "hello sir,",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "avalanch",
      "parent_permlink": "tg9kwj",
      "permlink": "tg883t",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-07T14:53:54",
  "trx_id": "4006d47d23f14509f15386685afd42a06abb60ce",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrureplied to @rme / tg882s
2026/06/07 14:53:15
authorazeemgru
bodyHello every one
json metadata{"app":"steemit/0.2"}
parent authorrme
parent permlinkfun-meme-usdpuss-logo-meme-banner-part-440
permlinktg882s
title
Transaction InfoBlock #106734629/Trx 2c5d980102838ccbcd8cc73b25d5156d69afa925
View Raw JSON Data
{
  "block": 106734629,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Hello every one",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "rme",
      "parent_permlink": "fun-meme-usdpuss-logo-meme-banner-part-440",
      "permlink": "tg882s",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-07T14:53:15",
  "trx_id": "2c5d980102838ccbcd8cc73b25d5156d69afa925",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/06/07 14:52:24
authorazeemgru
bodyhi
json metadata{"app":"steemit/0.2"}
parent authorsajibibon84
parent permlinktg7roa
permlinktg881c
title
Transaction InfoBlock #106734612/Trx 638152023f43657e4f2a14729a6c20e87f7f65c8
View Raw JSON Data
{
  "block": 106734612,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "hi",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "sajibibon84",
      "parent_permlink": "tg7roa",
      "permlink": "tg881c",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-07T14:52:24",
  "trx_id": "638152023f43657e4f2a14729a6c20e87f7f65c8",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrupublished a new post: healthy-hair-guide-2026
2026/06/07 12:39:00
authorazeemgru
bodyHealthy Hair Guide 2026 صحت مند ہیئر گائیڈ 2026 ![#health #hair #healthyhair #beauty #lifestyle #wellness #haircare #steemit #blog #naturalremedies.png](https://cdn.steemitimages.com/DQmUj5zetd4rqax8a9KptfKSF5n7r2W7i5Y6Y5SzfKJDxmT/%23health%20%23hair%20%23healthyhair%20%23beauty%20%23lifestyle%20%23wellness%20%23haircare%20%23steemit%20%23blog%20%23naturalremedies.png) (Strategies for Quicker Hair Development) تیز بالوں کی نشوونما کے لیے حکمت عملی Discover ten (tried-and-true) methods for natural, healthy hair growth. Learn which (diets), hair care practices, and natural cures are best for (healthier), (shinier), and stronger hair in 2026. Healthy Hair Guide: A healthy lifestyle is the first step toward healthy hair. Consume foods high in protein, such as (nuts, fish, and eggs). To keep your hair hydrated, drink lots of water. Use a gentle shampoo that is appropriate for the type of hair you have. Steer clear of overheating dryers and straighteners. To increase blood flow, massage your scalp on a daily basis. To preserve healthy development, trim split ends. Shield your hair from pollution and intense sunshine. Manage your stress levels and get adequate sleep. You may get stronger, more radiant, and healthier hair by taking regular care of your hair. More information visit here: www.healthgru.com
json metadata{"tags":["healthyhair","hairgrowth","haircare","blogging","fitthair","healthyhairguide"],"image":["https://cdn.steemitimages.com/DQmUj5zetd4rqax8a9KptfKSF5n7r2W7i5Y6Y5SzfKJDxmT/%23health%20%23hair%20%23healthyhair%20%23beauty%20%23lifestyle%20%23wellness%20%23haircare%20%23steemit%20%23blog%20%23naturalremedies.png"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkhealthyhair
permlinkhealthy-hair-guide-2026
titleHealthy Hair Guide 2026
Transaction InfoBlock #106731948/Trx 8a40e0218ce442ac4851da6a7eff8295d26ad0ff
View Raw JSON Data
{
  "block": 106731948,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Healthy Hair Guide 2026\nصحت مند ہیئر گائیڈ 2026\n![#health #hair #healthyhair #beauty #lifestyle #wellness #haircare #steemit #blog #naturalremedies.png](https://cdn.steemitimages.com/DQmUj5zetd4rqax8a9KptfKSF5n7r2W7i5Y6Y5SzfKJDxmT/%23health%20%23hair%20%23healthyhair%20%23beauty%20%23lifestyle%20%23wellness%20%23haircare%20%23steemit%20%23blog%20%23naturalremedies.png)\n\n(Strategies for Quicker Hair Development)\nتیز بالوں کی نشوونما کے لیے حکمت عملی\nDiscover ten (tried-and-true) methods for natural, healthy hair growth. Learn which (diets), hair care practices, and natural cures are best for (healthier), (shinier), and stronger hair in 2026.\n\nHealthy Hair Guide:\nA healthy lifestyle is the first step toward healthy hair. Consume foods high in protein, such as (nuts, fish, and eggs). To keep your hair hydrated, drink lots of water. Use a gentle shampoo that is appropriate for the type of hair you have. Steer clear of overheating dryers and straighteners. To increase blood flow, massage your scalp on a daily basis. To preserve healthy development, trim split ends. Shield your hair from pollution and intense sunshine. Manage your stress levels and get adequate sleep. You may get stronger, more radiant, and healthier hair by taking regular care of your hair.\nMore information visit here: www.healthgru.com",
      "json_metadata": "{\"tags\":[\"healthyhair\",\"hairgrowth\",\"haircare\",\"blogging\",\"fitthair\",\"healthyhairguide\"],\"image\":[\"https://cdn.steemitimages.com/DQmUj5zetd4rqax8a9KptfKSF5n7r2W7i5Y6Y5SzfKJDxmT/%23health%20%23hair%20%23healthyhair%20%23beauty%20%23lifestyle%20%23wellness%20%23haircare%20%23steemit%20%23blog%20%23naturalremedies.png\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "healthyhair",
      "permlink": "healthy-hair-guide-2026",
      "title": "Healthy Hair Guide 2026"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-07T12:39:00",
  "trx_id": "8a40e0218ce442ac4851da6a7eff8295d26ad0ff",
  "trx_in_block": 9,
  "virtual_op": 0
}
azeemgruupdated their account properties
2026/06/05 16:43:51
accountazeemgru
extensions[]
json metadata
posting json metadata{"profile":{"profile_image":"https://cdn.steemitimages.com/DQmSffJ4CLyhWjtK3XxJ1jWvQPjGZzASBymqtjZ8FnUxGr7/ChatGPT%20Image%20Jun%205,%202026,%2001_28_12%20AM.png","cover_image":"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png","name":"Azeem Sarwar","about":"i am a content writer,","version":2,"location":"Pakistan"}}
Transaction InfoBlock #106679378/Trx a95eda8decf0fd6a4406fe8a3eb86923693aea88
View Raw JSON Data
{
  "block": 106679378,
  "op": [
    "account_update2",
    {
      "account": "azeemgru",
      "extensions": [],
      "json_metadata": "",
      "posting_json_metadata": "{\"profile\":{\"profile_image\":\"https://cdn.steemitimages.com/DQmSffJ4CLyhWjtK3XxJ1jWvQPjGZzASBymqtjZ8FnUxGr7/ChatGPT%20Image%20Jun%205,%202026,%2001_28_12%20AM.png\",\"cover_image\":\"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png\",\"name\":\"Azeem Sarwar\",\"about\":\"i am a  content writer,\",\"version\":2,\"location\":\"Pakistan\"}}"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T16:43:51",
  "trx_id": "a95eda8decf0fd6a4406fe8a3eb86923693aea88",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrureplied to @mivo67 / tg4jal
2026/06/05 16:37:06
authorazeemgru
bodyhi
json metadata{"app":"steemit/0.2"}
parent authormivo67
parent permlinkdinkel-roggen-volkornbrot-20260308161538
permlinktg4jal
title
Transaction InfoBlock #106679245/Trx 3583fe81f0b09ec632e4a6d6758db2b3b70455e2
View Raw JSON Data
{
  "block": 106679245,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "hi",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "mivo67",
      "parent_permlink": "dinkel-roggen-volkornbrot-20260308161538",
      "permlink": "tg4jal",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T16:37:06",
  "trx_id": "3583fe81f0b09ec632e4a6d6758db2b3b70455e2",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrureplied to @nirog / tg4j9m
2026/06/05 16:36:30
authorazeemgru
bodyhello friends
json metadata{"app":"steemit/0.2"}
parent authornirog
parent permlinkayurvedic-diabetes-care-plan-for-better-lifestyle-balance
permlinktg4j9m
title
Transaction InfoBlock #106679233/Trx cae4ccee6d48c2a4a0ff0e804a9bf1eb15e0255d
View Raw JSON Data
{
  "block": 106679233,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "hello friends",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "nirog",
      "parent_permlink": "ayurvedic-diabetes-care-plan-for-better-lifestyle-balance",
      "permlink": "tg4j9m",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T16:36:30",
  "trx_id": "cae4ccee6d48c2a4a0ff0e804a9bf1eb15e0255d",
  "trx_in_block": 3,
  "virtual_op": 0
}
2026/06/05 16:35:51
authorazeemgru
bodyEarly Signs of Type 2 Diabetes ٹائپ 2 ذیابیطس کی ابتدائی علامات ![diabetes.JPG](https://cdn.steemitimages.com/DQmdek1ahtAofh6WkmFXzbtz5FX6vjcazWgSeHD4QcdTfZx/diabetes.JPG) Early Signs Your Body Is Asking for Help ابتدائی نشانیاں آپ کا جسم مدد کے لیے پوچھ رہا ہے More information visit here: www.healtgru.com
json metadata{"tags":["diabetes","type2diabetes","medical","prevention","lifestyle","awareness","steemit","blog"],"image":["https://cdn.steemitimages.com/DQmdek1ahtAofh6WkmFXzbtz5FX6vjcazWgSeHD4QcdTfZx/diabetes.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkdiabetes
permlinkearly-signs-of-type-2-diabetes
titleEarly Signs of Type 2 Diabetes
Transaction InfoBlock #106679220/Trx c98975e747dea53e2af009615a175c5dd49cbbf5
View Raw JSON Data
{
  "block": 106679220,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Early Signs of Type 2 Diabetes\nٹائپ 2 ذیابیطس کی ابتدائی علامات\n\n![diabetes.JPG](https://cdn.steemitimages.com/DQmdek1ahtAofh6WkmFXzbtz5FX6vjcazWgSeHD4QcdTfZx/diabetes.JPG)\n\nEarly Signs Your Body Is Asking for Help\nابتدائی نشانیاں آپ کا جسم مدد کے لیے پوچھ رہا ہے\n\nMore information visit here: www.healtgru.com",
      "json_metadata": "{\"tags\":[\"diabetes\",\"type2diabetes\",\"medical\",\"prevention\",\"lifestyle\",\"awareness\",\"steemit\",\"blog\"],\"image\":[\"https://cdn.steemitimages.com/DQmdek1ahtAofh6WkmFXzbtz5FX6vjcazWgSeHD4QcdTfZx/diabetes.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "diabetes",
      "permlink": "early-signs-of-type-2-diabetes",
      "title": "Early Signs of Type 2 Diabetes"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T16:35:51",
  "trx_id": "c98975e747dea53e2af009615a175c5dd49cbbf5",
  "trx_in_block": 4,
  "virtual_op": 0
}
2026/06/05 13:47:24
authorazeemgru
bodyHello every one
json metadata{"app":"steemit/0.2"}
parent authoriffatilyas
parent permlinka-day-filled-with-care-and-celebration-xk6odo
permlinktg4jti
title
Transaction InfoBlock #106675860/Trx 560e3aa3659b912e41ad2495f2788eb0277ea662
View Raw JSON Data
{
  "block": 106675860,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Hello every one",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "iffatilyas",
      "parent_permlink": "a-day-filled-with-care-and-celebration-xk6odo",
      "permlink": "tg4jti",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T13:47:24",
  "trx_id": "560e3aa3659b912e41ad2495f2788eb0277ea662",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/06/05 13:46:42
authoriffatilyas
permlinka-day-filled-with-care-and-celebration-xk6odo
voterazeemgru
weight10000 (100.00%)
Transaction InfoBlock #106675846/Trx c8a342e8dfde24406a3a225b034042f943af06f5
View Raw JSON Data
{
  "block": 106675846,
  "op": [
    "vote",
    {
      "author": "iffatilyas",
      "permlink": "a-day-filled-with-care-and-celebration-xk6odo",
      "voter": "azeemgru",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T13:46:42",
  "trx_id": "c8a342e8dfde24406a3a225b034042f943af06f5",
  "trx_in_block": 2,
  "virtual_op": 0
}
2026/06/05 13:40:45
authorazeemgru
bodyاپنے نپلز کو قدرتی طور پر صحت مند کیسے رکھیں ![breast health.JPG](https://cdn.steemitimages.com/DQmYhP53ZEi5hkREb5JFRkvSRwAemQqQWX8HS1Xifn6NtFn/breast%20health.JPG) نپل کیئر #NippleCare #BreastHealth #WomenHealth #HealthyWomen #HealthTips #SelfCare #WellnessJourney #HealthAwareness #HealthyLifestyle #WomenWellness #MedicalAwareness #BodyCare #HealthEducation #SteemitHealth #HealthyLiving
json metadata{"tags":["nipplecare","bodycare","steemithealth","breasthealth","nippletips","womenhealth","healthywomen","healthtips"],"image":["https://cdn.steemitimages.com/DQmYhP53ZEi5hkREb5JFRkvSRwAemQqQWX8HS1Xifn6NtFn/breast%20health.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinknipplecare
permlinkhow-to-keep-your-nipples-healthy-naturally
titleHow to Keep Your Nipples Healthy Naturally
Transaction InfoBlock #106675727/Trx 1e6c01c1b3899e3b436cac21f22826d5b8508d1a
View Raw JSON Data
{
  "block": 106675727,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "اپنے نپلز کو قدرتی طور پر صحت مند کیسے رکھیں\n\n![breast health.JPG](https://cdn.steemitimages.com/DQmYhP53ZEi5hkREb5JFRkvSRwAemQqQWX8HS1Xifn6NtFn/breast%20health.JPG)\n\nنپل کیئر\n#NippleCare #BreastHealth #WomenHealth #HealthyWomen #HealthTips #SelfCare\n#WellnessJourney #HealthAwareness #HealthyLifestyle #WomenWellness\n#MedicalAwareness #BodyCare #HealthEducation #SteemitHealth #HealthyLiving",
      "json_metadata": "{\"tags\":[\"nipplecare\",\"bodycare\",\"steemithealth\",\"breasthealth\",\"nippletips\",\"womenhealth\",\"healthywomen\",\"healthtips\"],\"image\":[\"https://cdn.steemitimages.com/DQmYhP53ZEi5hkREb5JFRkvSRwAemQqQWX8HS1Xifn6NtFn/breast%20health.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "nipplecare",
      "permlink": "how-to-keep-your-nipples-healthy-naturally",
      "title": "How to Keep Your Nipples Healthy Naturally"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-05T13:40:45",
  "trx_id": "1e6c01c1b3899e3b436cac21f22826d5b8508d1a",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/06/04 18:02:45
authorazeemgru
permlinknatural-breast-health-tips-for-beginners
voterseribubulan
weight10000 (100.00%)
Transaction InfoBlock #106652218/Trx 09f80d95fb2b3aa5a1b9271d383721b5bc64a493
View Raw JSON Data
{
  "block": 106652218,
  "op": [
    "vote",
    {
      "author": "azeemgru",
      "permlink": "natural-breast-health-tips-for-beginners",
      "voter": "seribubulan",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T18:02:45",
  "trx_id": "09f80d95fb2b3aa5a1b9271d383721b5bc64a493",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/06/04 18:00:57
authorazeemgru
bodyWomen's Breast Health: Simple Tips for a Healthy Life خواتین کی چھاتی کی صحت: صحت مند زندگی کے لیے آسان نکات ![#BreastHealth #WomenHealth #HealthyLifestyle #HealthAwareness #SelfCare #Wellness #HealthyLiving #MedicalTips #SteemitHealth #HealthEducation.JPG](https://cdn.steemitimages.com/DQmNj8PXeFgBA1xhQNzf9j8MLqvvVvhx57CivGvaDhxfMR6/%23BreastHealth%20%23WomenHealth%20%23HealthyLifestyle%20%23HealthAwareness%20%23SelfCare%20%23Wellness%20%23HealthyLiving%20%23MedicalTips%20%23SteemitHealth%20%23HealthEducation.JPG) چھاتی کی صحت ہر عورت کی مجموعی بہبود کا ایک اہم حصہ ہے۔ صحت مند طرز زندگی کو برقرار رکھنے سے چھاتی کی صحت اور معیار زندگی کو بہتر بنانے میں مدد مل سکتی ہے۔ Here are some basic pointers: پھلوں اور سبزیوں سے بھرپور متوازن غذا کھائیں۔ صحت مند وزن کو برقرار رکھنے کے لیے باقاعدگی سے ورزش کریں۔ تمباکو نوشی سے پرہیز کریں اور شراب نوشی کو محدود کریں۔ کسی بھی غیر معمولی تبدیلی کو محسوس کرنے کے لیے چھاتی کا باقاعدگی سے خود معائنہ کریں۔ اپنے صحت کی دیکھ بھال فراہم کرنے والے کی تجویز کے مطابق معمول کے طبی چیک اپ اور اسکریننگ کا شیڈول بنائیں۔ آپ ابھی اپنی صحت کا خیال رکھ کر مستقبل میں اپنی طاقت اور صحت کو برقرار رکھ سکتے ہیں۔ چھاتی کی صحت کو برقرار رکھنے کے لیے آگاہی، روک تھام اور معمول کے امتحانات کی ضرورت ہوتی ہے۔ آپ کا بہترین اثاثہ آپ کی صحت ہے، اس لیے روزانہ اس کا خیال رکھیں۔ More information visit here: www.healthgru.com
json metadata{"tags":["breasthealth","womenhealth","healthawareness","medicaltips","steemithealth"],"image":["https://cdn.steemitimages.com/DQmNj8PXeFgBA1xhQNzf9j8MLqvvVvhx57CivGvaDhxfMR6/%23BreastHealth%20%23WomenHealth%20%23HealthyLifestyle%20%23HealthAwareness%20%23SelfCare%20%23Wellness%20%23HealthyLiving%20%23MedicalTips%20%23SteemitHealth%20%23HealthEducation.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkbreasthealth
permlinknatural-breast-health-tips-for-beginners
titleNatural Breast Health Tips for Beginners
Transaction InfoBlock #106652182/Trx e0efcfecdef967103de8f71b4d49da7625031e25
View Raw JSON Data
{
  "block": 106652182,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Women's Breast Health: Simple Tips for a Healthy Life\nخواتین کی چھاتی کی صحت: صحت مند زندگی کے لیے آسان نکات\n\n![#BreastHealth #WomenHealth #HealthyLifestyle #HealthAwareness #SelfCare #Wellness #HealthyLiving #MedicalTips #SteemitHealth #HealthEducation.JPG](https://cdn.steemitimages.com/DQmNj8PXeFgBA1xhQNzf9j8MLqvvVvhx57CivGvaDhxfMR6/%23BreastHealth%20%23WomenHealth%20%23HealthyLifestyle%20%23HealthAwareness%20%23SelfCare%20%23Wellness%20%23HealthyLiving%20%23MedicalTips%20%23SteemitHealth%20%23HealthEducation.JPG)\n\nچھاتی کی صحت ہر عورت کی مجموعی بہبود کا ایک اہم حصہ ہے۔ صحت مند طرز زندگی کو برقرار رکھنے سے چھاتی کی صحت اور معیار زندگی کو بہتر بنانے میں مدد مل سکتی ہے۔\n\nHere are some basic pointers:\n\nپھلوں اور سبزیوں سے بھرپور متوازن غذا کھائیں۔\n صحت مند وزن کو برقرار رکھنے کے لیے باقاعدگی سے ورزش کریں۔\n تمباکو نوشی سے پرہیز کریں اور شراب نوشی کو محدود کریں۔\n کسی بھی غیر معمولی تبدیلی کو محسوس کرنے کے لیے چھاتی کا باقاعدگی سے خود معائنہ کریں۔\n اپنے صحت کی دیکھ بھال فراہم کرنے والے کی تجویز کے مطابق معمول کے طبی چیک اپ اور اسکریننگ کا شیڈول بنائیں۔\n\nآپ ابھی اپنی صحت کا خیال رکھ کر مستقبل میں اپنی طاقت اور صحت کو برقرار رکھ سکتے ہیں۔ چھاتی کی صحت کو برقرار رکھنے کے لیے آگاہی، روک تھام اور معمول کے امتحانات کی ضرورت ہوتی ہے۔\nآپ کا بہترین اثاثہ آپ کی صحت ہے، اس لیے روزانہ اس کا خیال رکھیں۔\n\nMore information visit here: www.healthgru.com",
      "json_metadata": "{\"tags\":[\"breasthealth\",\"womenhealth\",\"healthawareness\",\"medicaltips\",\"steemithealth\"],\"image\":[\"https://cdn.steemitimages.com/DQmNj8PXeFgBA1xhQNzf9j8MLqvvVvhx57CivGvaDhxfMR6/%23BreastHealth%20%23WomenHealth%20%23HealthyLifestyle%20%23HealthAwareness%20%23SelfCare%20%23Wellness%20%23HealthyLiving%20%23MedicalTips%20%23SteemitHealth%20%23HealthEducation.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "breasthealth",
      "permlink": "natural-breast-health-tips-for-beginners",
      "title": "Natural Breast Health Tips for Beginners"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T18:00:57",
  "trx_id": "e0efcfecdef967103de8f71b4d49da7625031e25",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:57
idcommunity
json["subscribe",{"community":"hive-168424"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651124/Trx 268a816c459cc510dd82993aecc0678fe85de711
View Raw JSON Data
{
  "block": 106651124,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-168424\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:57",
  "trx_id": "268a816c459cc510dd82993aecc0678fe85de711",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:51
idcommunity
json["subscribe",{"community":"hive-153018"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651122/Trx af9447a7553c3252dd252d42e01e6776cc0c8280
View Raw JSON Data
{
  "block": 106651122,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-153018\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:51",
  "trx_id": "af9447a7553c3252dd252d42e01e6776cc0c8280",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:45
idcommunity
json["subscribe",{"community":"hive-138939"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651120/Trx 9456aaa5d0aa501cfd0fe4f023064f99abad0159
View Raw JSON Data
{
  "block": 106651120,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-138939\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:45",
  "trx_id": "9456aaa5d0aa501cfd0fe4f023064f99abad0159",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:42
idcommunity
json["subscribe",{"community":"hive-124393"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651119/Trx c74cdfeaba60e8a12fe8fd174b5eb5c779104d5b
View Raw JSON Data
{
  "block": 106651119,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-124393\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:42",
  "trx_id": "c74cdfeaba60e8a12fe8fd174b5eb5c779104d5b",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:33
idcommunity
json["subscribe",{"community":"hive-159906"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651116/Trx d2a12980558884423cd3a6f325dcf13541705144
View Raw JSON Data
{
  "block": 106651116,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-159906\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:33",
  "trx_id": "d2a12980558884423cd3a6f325dcf13541705144",
  "trx_in_block": 3,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:30
idcommunity
json["subscribe",{"community":"hive-152587"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651115/Trx 4fa342cd92702d7a639bbbb81b4c6c51af09becc
View Raw JSON Data
{
  "block": 106651115,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-152587\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:30",
  "trx_id": "4fa342cd92702d7a639bbbb81b4c6c51af09becc",
  "trx_in_block": 3,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:24
idcommunity
json["subscribe",{"community":"hive-142124"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651113/Trx 34083d7d8d3f1123896a74027ec6e2167b237109
View Raw JSON Data
{
  "block": 106651113,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-142124\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:24",
  "trx_id": "34083d7d8d3f1123896a74027ec6e2167b237109",
  "trx_in_block": 3,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:21
idcommunity
json["subscribe",{"community":"hive-194651"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651112/Trx ec7613b5ab046d7eb67be9907ec9da9125ab2f17
View Raw JSON Data
{
  "block": 106651112,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-194651\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:21",
  "trx_id": "ec7613b5ab046d7eb67be9907ec9da9125ab2f17",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/04 17:07:18
idcommunity
json["subscribe",{"community":"hive-109934"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106651111/Trx e2990679caf7fd2f51b222bf64796e59dd016a0c
View Raw JSON Data
{
  "block": 106651111,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-109934\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-04T17:07:18",
  "trx_id": "e2990679caf7fd2f51b222bf64796e59dd016a0c",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:57
idcommunity
json["subscribe",{"community":"hive-120823"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623630/Trx 31894eaabe8081e9c2341879f376e0eacffa2da2
View Raw JSON Data
{
  "block": 106623630,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-120823\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:57",
  "trx_id": "31894eaabe8081e9c2341879f376e0eacffa2da2",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:54
idcommunity
json["subscribe",{"community":"hive-150943"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623629/Trx 6e5e14791baea96cfd8a5a3a70ed2d11d2599ab9
View Raw JSON Data
{
  "block": 106623629,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-150943\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:54",
  "trx_id": "6e5e14791baea96cfd8a5a3a70ed2d11d2599ab9",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:36
idcommunity
json["subscribe",{"community":"hive-179660"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623623/Trx 26ebbe58e418f68a804dacdd9d9e46473eb57636
View Raw JSON Data
{
  "block": 106623623,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-179660\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:36",
  "trx_id": "26ebbe58e418f68a804dacdd9d9e46473eb57636",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:24
idcommunity
json["subscribe",{"community":"hive-177926"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623619/Trx 7fc85119ed8f26fbaa0bdbb07ca97c0da9c09501
View Raw JSON Data
{
  "block": 106623619,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-177926\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:24",
  "trx_id": "7fc85119ed8f26fbaa0bdbb07ca97c0da9c09501",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:18
idcommunity
json["subscribe",{"community":"hive-180106"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623617/Trx 9248cacff6b18b117c807c6b06fa07a2f25c689a
View Raw JSON Data
{
  "block": 106623617,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-180106\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:18",
  "trx_id": "9248cacff6b18b117c807c6b06fa07a2f25c689a",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:15
idcommunity
json["subscribe",{"community":"hive-174315"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623616/Trx 73aee0357a7226c1421a3343957104881f0f6ff7
View Raw JSON Data
{
  "block": 106623616,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-174315\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:15",
  "trx_id": "73aee0357a7226c1421a3343957104881f0f6ff7",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:09:06
idcommunity
json["subscribe",{"community":"hive-185836"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623613/Trx 000713fdc4ed4f5e81475916f880d761d351bb84
View Raw JSON Data
{
  "block": 106623613,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-185836\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:09:06",
  "trx_id": "000713fdc4ed4f5e81475916f880d761d351bb84",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:08:57
idcommunity
json["subscribe",{"community":"hive-196917"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623610/Trx eb8a684a8b2a3272a8e38431ab7ef3a4adbe32aa
View Raw JSON Data
{
  "block": 106623610,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-196917\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:08:57",
  "trx_id": "eb8a684a8b2a3272a8e38431ab7ef3a4adbe32aa",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:08:51
idcommunity
json["subscribe",{"community":"hive-150122"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623608/Trx 351b554aa7bc9f49c1c315537005608bec411204
View Raw JSON Data
{
  "block": 106623608,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-150122\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:08:51",
  "trx_id": "351b554aa7bc9f49c1c315537005608bec411204",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:08:45
idcommunity
json["subscribe",{"community":"hive-183959"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623606/Trx 400161a07b337c15afea98205fbb55b05242dcaa
View Raw JSON Data
{
  "block": 106623606,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-183959\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:08:45",
  "trx_id": "400161a07b337c15afea98205fbb55b05242dcaa",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:08:42
idcommunity
json["subscribe",{"community":"hive-180932"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623605/Trx 7c7d7d9bd5d2e88bd96eb76126a053b444267268
View Raw JSON Data
{
  "block": 106623605,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-180932\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:08:42",
  "trx_id": "7c7d7d9bd5d2e88bd96eb76126a053b444267268",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:08:36
idcommunity
json["unsubscribe",{"community":"hive-196917"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623603/Trx 9138d45b7b1670f16c7c2fe3cc36948b018636ed
View Raw JSON Data
{
  "block": 106623603,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"unsubscribe\",{\"community\":\"hive-196917\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:08:36",
  "trx_id": "9138d45b7b1670f16c7c2fe3cc36948b018636ed",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/03 18:08:33
idcommunity
json["unsubscribe",{"community":"hive-150122"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106623602/Trx eeb3bd563722683d4a9a7defc81508630f258b7a
View Raw JSON Data
{
  "block": 106623602,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"unsubscribe\",{\"community\":\"hive-150122\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T18:08:33",
  "trx_id": "eeb3bd563722683d4a9a7defc81508630f258b7a",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrupublished a new post: diabetes-control-tips
2026/06/03 17:45:27
authorazeemgru
bodyDiabetes Control Tips ذیابیطس کنٹرول کے نکات ![#diabetes #health #healthyfood #fitness #wellness #healthylifestyle #nutrition #steemit #blog #medicalhealth #steemit.png](https://cdn.steemitimages.com/DQmdDouSz1Mfk4uzbakiWQQXQjn8fqf7iu59LYMxbxFVijW/%23diabetes%20%23health%20%23healthyfood%20%23fitness%20%23wellness%20%23healthylifestyle%20%23nutrition%20%23steemit%20%23blog%20%23medicalhealth%20%23steemit.png) شوگر سے پاک زندگی (sugar free life) Millions of individuals worldwide suffer from diabetes, a prevalent medical ailment. (Diabetes cannot be cured, but it can be properly managed with a healthy lifestyle). (sugar free life) Keeping a balanced diet is one of the most crucial diabetes management strategies. Consuming fruits, nutritious grains, lean meats, and fresh vegetables in moderation will help maintain stable blood sugar levels. Steer clear of processed foods and (sugar-filled) beverages as well. Frequent exercise is essential for managing diabetes. Everyday walks of thirty minutes can enhance insulin sensitivity and promote general health. Both getting adequate sleep and staying hydrated are crucial. People can better understand how their bodies react to diet and exercise by routinely checking their blood sugar levels. Complication risk can be further decreased by heeding medical advice and taking prescription drugs as directed. People with diabetes can live active, (healthy lives) by making small, regular lifestyle modifications. (Stay healthy, stay active, and take control of your diabetes today) .صحت مند رہیں، متحرک رہیں، اور آج ہی اپنی ذیابیطس پر قابو پالیں
json metadata{"tags":["diabetes","health","sugar","steemit","medicalhealth"],"image":["https://cdn.steemitimages.com/DQmdDouSz1Mfk4uzbakiWQQXQjn8fqf7iu59LYMxbxFVijW/%23diabetes%20%23health%20%23healthyfood%20%23fitness%20%23wellness%20%23healthylifestyle%20%23nutrition%20%23steemit%20%23blog%20%23medicalhealth%20%23steemit.png"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkdiabetes
permlinkdiabetes-control-tips
titleDiabetes Control Tips
Transaction InfoBlock #106623141/Trx fa62fdfeb1e6493c3301e90f6f32296eecd4adfd
View Raw JSON Data
{
  "block": 106623141,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Diabetes Control Tips\nذیابیطس کنٹرول کے نکات\n\n![#diabetes #health #healthyfood #fitness #wellness #healthylifestyle #nutrition #steemit #blog #medicalhealth #steemit.png](https://cdn.steemitimages.com/DQmdDouSz1Mfk4uzbakiWQQXQjn8fqf7iu59LYMxbxFVijW/%23diabetes%20%23health%20%23healthyfood%20%23fitness%20%23wellness%20%23healthylifestyle%20%23nutrition%20%23steemit%20%23blog%20%23medicalhealth%20%23steemit.png)\nشوگر سے پاک زندگی\n(sugar free life) Millions of individuals worldwide suffer from diabetes, a prevalent medical ailment. (Diabetes cannot be cured, but it can be properly managed with a healthy lifestyle).\n\n(sugar free life) Keeping a balanced diet is one of the most crucial diabetes management strategies. Consuming fruits, nutritious grains, lean meats, and fresh vegetables in moderation will help maintain stable blood sugar levels. Steer clear of processed foods and (sugar-filled) beverages as well.\n\nFrequent exercise is essential for managing diabetes. Everyday walks of thirty minutes can enhance insulin sensitivity and promote general health. Both getting adequate sleep and staying hydrated are crucial.\n\nPeople can better understand how their bodies react to diet and exercise by routinely checking their blood sugar levels. Complication risk can be further decreased by heeding medical advice and taking prescription drugs as directed.\n\nPeople with diabetes can live active, (healthy lives) by making small, regular lifestyle modifications.\n\n(Stay healthy, stay active, and take control of your diabetes today)\n.صحت مند رہیں، متحرک رہیں، اور آج ہی اپنی ذیابیطس پر قابو پالیں",
      "json_metadata": "{\"tags\":[\"diabetes\",\"health\",\"sugar\",\"steemit\",\"medicalhealth\"],\"image\":[\"https://cdn.steemitimages.com/DQmdDouSz1Mfk4uzbakiWQQXQjn8fqf7iu59LYMxbxFVijW/%23diabetes%20%23health%20%23healthyfood%20%23fitness%20%23wellness%20%23healthylifestyle%20%23nutrition%20%23steemit%20%23blog%20%23medicalhealth%20%23steemit.png\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "diabetes",
      "permlink": "diabetes-control-tips",
      "title": "Diabetes Control Tips"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T17:45:27",
  "trx_id": "fa62fdfeb1e6493c3301e90f6f32296eecd4adfd",
  "trx_in_block": 2,
  "virtual_op": 0
}
2026/06/03 15:15:24
authorazeemgru
body@@ -26,16 +26,46 @@ g Weight +%0A%D9%88%D8%B2%D9%86 %DA%A9%D9%85 %DA%A9%D8%B1%D9%86%DB%92 %DA%A9%DB%92 %D9%84%DB%8C%DB%92 %D9%B9%D8%A7%D9%BE 10 %D9%B9%D9%BE%D8%B3 %0A%0A!%5B#Wei @@ -393,16 +393,41 @@ m.png)%0A%0A +%D9%88%D8%B2%D9%86 %DA%A9%D9%85 %DA%A9%D8%B1%D9%86%D8%A7 %D9%85%D8%B4%DA%A9%D9%84 %D9%86%DB%81%DB%8C%DA%BA %DB%81%DB%92%0A %0AIt does
json metadata{"app":"steemit/0.2","format":"markdown","image":["https://cdn.steemitimages.com/DQmePMw8fF7QdUVYcDLwWrawxMqxUaZaH64rLuNwcuGYg3j/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.png"],"tags":["health","healthylifestyle","diettips","steemit"]}
parent author
parent permlinkfitness
permlinkthe-top-10-tips-for-losing-weight
titleThe Top 10 Tips for Losing Weight
Transaction InfoBlock #106620144/Trx 008264a9f78a3265922ca64062636fadfe230923
View Raw JSON Data
{
  "block": 106620144,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "@@ -26,16 +26,46 @@\n g Weight\n+%0A%D9%88%D8%B2%D9%86 %DA%A9%D9%85 %DA%A9%D8%B1%D9%86%DB%92 %DA%A9%DB%92 %D9%84%DB%8C%DB%92 %D9%B9%D8%A7%D9%BE 10 %D9%B9%D9%BE%D8%B3\n %0A%0A!%5B#Wei\n@@ -393,16 +393,41 @@\n m.png)%0A%0A\n+%D9%88%D8%B2%D9%86 %DA%A9%D9%85 %DA%A9%D8%B1%D9%86%D8%A7 %D9%85%D8%B4%DA%A9%D9%84 %D9%86%DB%81%DB%8C%DA%BA %DB%81%DB%92%0A\n %0AIt does\n",
      "json_metadata": "{\"app\":\"steemit/0.2\",\"format\":\"markdown\",\"image\":[\"https://cdn.steemitimages.com/DQmePMw8fF7QdUVYcDLwWrawxMqxUaZaH64rLuNwcuGYg3j/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.png\"],\"tags\":[\"health\",\"healthylifestyle\",\"diettips\",\"steemit\"]}",
      "parent_author": "",
      "parent_permlink": "fitness",
      "permlink": "the-top-10-tips-for-losing-weight",
      "title": "The Top 10 Tips for Losing Weight"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T15:15:24",
  "trx_id": "008264a9f78a3265922ca64062636fadfe230923",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/06/03 15:12:36
authorazeemgru
body@@ -133,19 +133,19 @@ #Steem. -JPG +png %5D(https: @@ -176,51 +176,51 @@ DQme -VXtvvM7ajZ1W1AW91GD2RKWjGeDiwLEanVU1QttHXZT +PMw8fF7QdUVYcDLwWrawxMqxUaZaH64rLuNwcuGYg3j /%2523 @@ -361,12 +361,13 @@ eem. -JPG) +png)%0A %0A%0AIt
json metadata{"app":"steemit/0.2","format":"markdown","image":["https://cdn.steemitimages.com/DQmePMw8fF7QdUVYcDLwWrawxMqxUaZaH64rLuNwcuGYg3j/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.png"],"tags":["health","healthylifestyle","diettips","steemit"]}
parent author
parent permlinkfitness
permlinkthe-top-10-tips-for-losing-weight
titleThe Top 10 Tips for Losing Weight
Transaction InfoBlock #106620088/Trx 52b1f11dc33c0a34deed988bb6134c4133b08c9d
View Raw JSON Data
{
  "block": 106620088,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "@@ -133,19 +133,19 @@\n  #Steem.\n-JPG\n+png\n %5D(https:\n@@ -176,51 +176,51 @@\n DQme\n-VXtvvM7ajZ1W1AW91GD2RKWjGeDiwLEanVU1QttHXZT\n+PMw8fF7QdUVYcDLwWrawxMqxUaZaH64rLuNwcuGYg3j\n /%2523\n@@ -361,12 +361,13 @@\n eem.\n-JPG)\n+png)%0A\n %0A%0AIt\n",
      "json_metadata": "{\"app\":\"steemit/0.2\",\"format\":\"markdown\",\"image\":[\"https://cdn.steemitimages.com/DQmePMw8fF7QdUVYcDLwWrawxMqxUaZaH64rLuNwcuGYg3j/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.png\"],\"tags\":[\"health\",\"healthylifestyle\",\"diettips\",\"steemit\"]}",
      "parent_author": "",
      "parent_permlink": "fitness",
      "permlink": "the-top-10-tips-for-losing-weight",
      "title": "The Top 10 Tips for Losing Weight"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T15:12:36",
  "trx_id": "52b1f11dc33c0a34deed988bb6134c4133b08c9d",
  "trx_in_block": 3,
  "virtual_op": 0
}
2026/06/03 15:05:30
authorazeemgru
bodyThe Top 10 Tips for Losing Weight ![#WeightLoss #Fitness #Health #HealthyLifestyle #DietTips #Nutrition #Wellness #FitLife #Steemit #Steem.JPG](https://cdn.steemitimages.com/DQmeVXtvvM7ajZ1W1AW91GD2RKWjGeDiwLEanVU1QttHXZT/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.JPG) It doesn't have to be difficult to (lose weight). Your road toward health and fitness can be greatly impacted by small daily adjustments. These ten easy (weight loss) strategies will help you reach your objectives organically. (Drink lots of water all day long.) (Consume more fruits and vegetables.) (Avoid processed foods and sugar-filled beverages.) (Maintain portion control.) (Incorporate protein into each meal.) (Even if it's only a daily walk, get regular exercise.) (Adequately rest each night.) (Relax and practice mindfulness to reduce stress.) (Avoid munching late at night.) (Remain steady and patient with your advancement.) (healthgru.com) Developing lifelong healthy behaviors is more important for weight loss than finding fast remedies. You'll get closer to being a happier and healthier version of (yourself) if you make even one tiny change today.
json metadata{"tags":["fitness","health","healthylifestyle","diettips","steemit"],"image":["https://cdn.steemitimages.com/DQmeVXtvvM7ajZ1W1AW91GD2RKWjGeDiwLEanVU1QttHXZT/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkfitness
permlinkthe-top-10-tips-for-losing-weight
titleThe Top 10 Tips for Losing Weight
Transaction InfoBlock #106619947/Trx b78861808d3303f7e72a1fe8e75a9ce86972f318
View Raw JSON Data
{
  "block": 106619947,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "The Top 10 Tips for Losing Weight\n\n![#WeightLoss #Fitness #Health #HealthyLifestyle #DietTips #Nutrition #Wellness #FitLife #Steemit #Steem.JPG](https://cdn.steemitimages.com/DQmeVXtvvM7ajZ1W1AW91GD2RKWjGeDiwLEanVU1QttHXZT/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.JPG)\n\nIt doesn't have to be difficult to (lose weight). Your road toward health and fitness can be greatly impacted by small daily adjustments. These ten easy (weight loss) strategies will help you reach your objectives organically.\n\n(Drink lots of water all day long.)\n(Consume more fruits and vegetables.)\n(Avoid processed foods and sugar-filled beverages.)\n(Maintain portion control.)\n(Incorporate protein into each meal.)\n(Even if it's only a daily walk, get regular exercise.)\n(Adequately rest each night.)\n(Relax and practice mindfulness to reduce stress.)\n(Avoid munching late at night.)\n(Remain steady and patient with your advancement.)\n\n(healthgru.com) Developing lifelong healthy behaviors is more important for weight loss than finding fast remedies. You'll get closer to being a happier and healthier version of (yourself) if you make even one tiny change today.",
      "json_metadata": "{\"tags\":[\"fitness\",\"health\",\"healthylifestyle\",\"diettips\",\"steemit\"],\"image\":[\"https://cdn.steemitimages.com/DQmeVXtvvM7ajZ1W1AW91GD2RKWjGeDiwLEanVU1QttHXZT/%23WeightLoss%20%23Fitness%20%23Health%20%23HealthyLifestyle%20%23DietTips%20%23Nutrition%20%23Wellness%20%23FitLife%20%23Steemit%20%23Steem.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "fitness",
      "permlink": "the-top-10-tips-for-losing-weight",
      "title": "The Top 10 Tips for Losing Weight"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-03T15:05:30",
  "trx_id": "b78861808d3303f7e72a1fe8e75a9ce86972f318",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: notify
2026/06/02 13:33:18
idnotify
json["setLastRead",{"date":"2026-06-01T20:07:26"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106589396/Trx 50922ed0b9c858b21e9e509b3db707995c6cb06f
View Raw JSON Data
{
  "block": 106589396,
  "op": [
    "custom_json",
    {
      "id": "notify",
      "json": "[\"setLastRead\",{\"date\":\"2026-06-01T20:07:26\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-02T13:33:18",
  "trx_id": "50922ed0b9c858b21e9e509b3db707995c6cb06f",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: notify
2026/06/01 19:00:36
idnotify
json["setLastRead",{"date":"2026-05-31T20:59:50"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106567462/Trx 822343e51f905b536950f94534df315c6cd92ea8
View Raw JSON Data
{
  "block": 106567462,
  "op": [
    "custom_json",
    {
      "id": "notify",
      "json": "[\"setLastRead\",{\"date\":\"2026-05-31T20:59:50\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T19:00:36",
  "trx_id": "822343e51f905b536950f94534df315c6cd92ea8",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrupublished a new post: how-to-make-healthy-teeth
2026/06/01 18:58:48
authorazeemgru
bodyHow to make healthy teeth صحت مند دانت بنانے کا طریقہ ![#healthyteeth.JPG](https://cdn.steemitimages.com/DQmTo1WiaUnd1n6QS2nA2tV5cMvVMuWB41f9Ny8GZ4vXy59/%23healthyteeth.JPG) One of the first things people notice about you is your healthy bright grin. Beneath that self-assured smile, however, is a daily regimen that keeps your teeth strong, white, and decay-free. Maintaining your general health is equally as important as keeping your teeth looking nice. 1. (Daily Dental Care Is Important) The cornerstone of proper oral hygiene is brushing your teeth twice a day. To get rid of cavity-causing germs and plaque use fluoride toothpaste and a toothbrush with soft bristles. For optimal results, take your time and brush for at least two minutes each time. 2. (Flossing) The Crucial Step Flossing is crucial for getting rid of food particles and plaque in the spaces between teeth that your toothbrush cannot reach, yet many individuals forget to do it. To avoid gum disease and maintain a clean mouth, floss once a day. 3. (Eat Wisely for Strong Teeth) You may be surprised to learn how much your nutrition influences your dental health. Apples, carrots, and celery are examples of crunchy fruits and vegetables that naturally strengthen gums and clean teeth. Soda and sugary foods should be avoided because they nourish the bacteria that cause tooth decay. 4. (Remain Hydrated) Water helps remove bacteria and food particles. Additionally, it maintains the condition of your saliva, which naturally guards against tooth decay. After each meal or snack, make an effort to sip water. 5. (Frequent Dental Examinations) Get cleanings and examinations from your dentist at least twice a year. A dentist can identify early indicators of issues like cavities, gum disease, or enamel erosion before they worsen, even if your teeth appear healthy. 6. (Natural Remedies for Extra Care) To keep bacteria under control, you can add natural remedies to your routine, such as oil pulling with coconut oil or rinsing with salt water. These should never, however, take the place of routine brushing and flossing. (Concluding Remarks) Healthy teeth are a reflection of your inner well-being, not only a component of attractiveness. You may keep a brilliant smile that lasts a lifetime with frequent dental checkups, attentive diet, and a consistent routine.
json metadata{"tags":["healthyteeth","dentalhealth","oralcare","healthtips","steemhealth"],"image":["https://cdn.steemitimages.com/DQmTo1WiaUnd1n6QS2nA2tV5cMvVMuWB41f9Ny8GZ4vXy59/%23healthyteeth.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkhealthyteeth
permlinkhow-to-make-healthy-teeth
titleHow to make healthy teeth
Transaction InfoBlock #106567427/Trx aca54c49298f36135ebdd26a0a1330457d197c9b
View Raw JSON Data
{
  "block": 106567427,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "How to make healthy teeth\nصحت مند دانت بنانے کا طریقہ\n\n![#healthyteeth.JPG](https://cdn.steemitimages.com/DQmTo1WiaUnd1n6QS2nA2tV5cMvVMuWB41f9Ny8GZ4vXy59/%23healthyteeth.JPG)\n\n \nOne of the first things people notice about you is your healthy bright grin. Beneath that self-assured smile, however, is a daily regimen that keeps your teeth strong, white, and decay-free. Maintaining your general health is equally as important as keeping your teeth looking nice.\n\n1. (Daily Dental Care Is Important)\nThe cornerstone of proper oral hygiene is brushing your teeth twice a day. To get rid of cavity-causing germs and plaque use fluoride toothpaste and a toothbrush with soft bristles. For optimal results, take your time and brush for at least two minutes each time.\n\n2. (Flossing)\nThe Crucial Step Flossing is crucial for getting rid of food particles and plaque in the spaces between teeth that your toothbrush cannot reach, yet many individuals forget to do it. To avoid gum disease and maintain a clean mouth, floss once a day.\n\n3. (Eat Wisely for Strong Teeth)\nYou may be surprised to learn how much your nutrition influences your dental health. Apples, carrots, and celery are examples of crunchy fruits and vegetables that naturally strengthen gums and clean teeth. Soda and sugary foods should be avoided because they nourish the bacteria that cause tooth decay.\n\n4. (Remain Hydrated)\nWater helps remove bacteria and food particles. Additionally, it maintains the condition of your saliva, which naturally guards against tooth decay. After each meal or snack, make an effort to sip water. \n\n5. (Frequent Dental Examinations) \nGet cleanings and examinations from your dentist at least twice a year. A dentist can identify early indicators of issues like cavities, gum disease, or enamel erosion before they worsen, even if your teeth appear healthy.\n\n6. (Natural Remedies for Extra Care) \nTo keep bacteria under control, you can add natural remedies to your routine, such as oil pulling with coconut oil or rinsing with salt water. These should never, however, take the place of routine brushing and flossing. \n\n(Concluding Remarks) \nHealthy teeth are a reflection of your inner well-being, not only a component of attractiveness. You may keep a brilliant smile that lasts a lifetime with frequent dental checkups, attentive diet, and a consistent routine.",
      "json_metadata": "{\"tags\":[\"healthyteeth\",\"dentalhealth\",\"oralcare\",\"healthtips\",\"steemhealth\"],\"image\":[\"https://cdn.steemitimages.com/DQmTo1WiaUnd1n6QS2nA2tV5cMvVMuWB41f9Ny8GZ4vXy59/%23healthyteeth.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "healthyteeth",
      "permlink": "how-to-make-healthy-teeth",
      "title": "How to make healthy teeth"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T18:58:48",
  "trx_id": "aca54c49298f36135ebdd26a0a1330457d197c9b",
  "trx_in_block": 3,
  "virtual_op": 0
}
2026/06/01 18:43:12
idfollow
json["follow",{"follower":"azeemgru","following":"kawsar7731","what":["blog",""]}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106567115/Trx 0460bdd5c21a38d4869622005e6b2b077e3740fb
View Raw JSON Data
{
  "block": 106567115,
  "op": [
    "custom_json",
    {
      "id": "follow",
      "json": "[\"follow\",{\"follower\":\"azeemgru\",\"following\":\"kawsar7731\",\"what\":[\"blog\",\"\"]}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T18:43:12",
  "trx_id": "0460bdd5c21a38d4869622005e6b2b077e3740fb",
  "trx_in_block": 1,
  "virtual_op": 0
}
executive-boardsent 0.001 STEEM to @azeemgru- "❗ Hello @azeemgru, great that you are using the STEEM blockchain. The Executive Board sends you, as a small token of appreciation, an exclusive voucher worth up to 1000 Euros, which you can redeem via..."
2026/06/01 18:40:00
amount0.001 STEEM
fromexecutive-board
memo❗ Hello @azeemgru, great that you are using the STEEM blockchain. The Executive Board sends you, as a small token of appreciation, an exclusive voucher worth up to 1000 Euros, which you can redeem via the following link: https://zcash-innovation.blogspot.com/?voucher=QkVGRktfWQRHS0RMWE9Oak1HS0NGBElFRw
toazeemgru
Transaction InfoBlock #106567052/Trx c7138b57f9490b79140b8b47fa4607bcdf72b156
View Raw JSON Data
{
  "block": 106567052,
  "op": [
    "transfer",
    {
      "amount": "0.001 STEEM",
      "from": "executive-board",
      "memo": "❗ Hello @azeemgru, great that you are using the STEEM blockchain. The Executive Board sends you, as a small token of appreciation, an exclusive voucher worth up to 1000 Euros, which you can redeem via the following link: https://zcash-innovation.blogspot.com/?voucher=QkVGRktfWQRHS0RMWE9Oak1HS0NGBElFRw",
      "to": "azeemgru"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T18:40:00",
  "trx_id": "c7138b57f9490b79140b8b47fa4607bcdf72b156",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/06/01 18:38:21
authorazeemgru
body(The Ghosts of Germany) Myths, Mysteries, and Haunted Castles جرمنی کے بھوت: خرافات، اسرار، اور پریتوادت قلعے This image AI: ![#hauntedgermany.JPG](https://cdn.steemitimages.com/DQmNUpt68PQKmZWjjmt7GNvz3UK8dxQAvRmf2gu9XsxoTuN/%23hauntedgermany.JPG) (Dark woodlands) (eerie folklore) and some of the oldest castles in the world may all be found in Germany. In locations thought to be haunted, people have reported seeing enigmatic figures, hearing inexplicable footsteps, and seeing odd happenings for centuries. Frankenstein Castle is one of the most horrifying places. (at night) travelers report seeing spectral shadows roaming among the ruins. There are local traditions of spirits, witches, and (animals) who appear when the moon is high deep within the Black Forest. (The story) of the White Lady, a mysterious ghost rumored to appear before significant occasions or tragedies, is arguably the most (well-known) She is one of Germany's most enduring legends, with reports of sightings dating back hundreds of years. Are these tales just myths, or is there a supernatural aspect to (Germany's) prehistoric past? The legends continue to draw mystery fans and (thrill-seekers) from all around the world, even though the answer may never be found. Would you be willing to stay the night at a (haunted castle) in Germany? Please comments for post:
json metadata{"tags":["hauntedgermany","ghoststories","mystery","urbanlegends"],"image":["https://cdn.steemitimages.com/DQmNUpt68PQKmZWjjmt7GNvz3UK8dxQAvRmf2gu9XsxoTuN/%23hauntedgermany.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkhauntedgermany
permlinkgermany-s-most-haunted-places-will-give-you-chills
titleGermany's Most Haunted Places Will Give You Chills
Transaction InfoBlock #106567019/Trx 443ea6e95fed6f69dacb6398cab280b4747208a5
View Raw JSON Data
{
  "block": 106567019,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "(The Ghosts of Germany) Myths, Mysteries, and Haunted Castles\nجرمنی کے بھوت: خرافات، اسرار، اور پریتوادت قلعے\nThis image AI:\n![#hauntedgermany.JPG](https://cdn.steemitimages.com/DQmNUpt68PQKmZWjjmt7GNvz3UK8dxQAvRmf2gu9XsxoTuN/%23hauntedgermany.JPG)\n\n(Dark woodlands) (eerie folklore) and some of the oldest castles in the world may all be found in Germany. In locations thought to be haunted, people have reported seeing enigmatic figures, hearing inexplicable footsteps, and seeing odd happenings for centuries.\n\nFrankenstein Castle is one of the most horrifying places. (at night) travelers report seeing spectral shadows roaming among the ruins. There are local traditions of spirits, witches, and (animals) who appear when the moon is high deep within the Black Forest.\n\n(The story) of the White Lady, a mysterious ghost rumored to appear before significant occasions or tragedies, is arguably the most (well-known) She is one of Germany's most enduring legends, with reports of sightings dating back hundreds of years.\n\nAre these tales just myths, or is there a supernatural aspect to (Germany's) prehistoric past? The legends continue to draw mystery fans and (thrill-seekers) from all around the world, even though the answer may never be found.\n\nWould you be willing to stay the night at a (haunted castle) in Germany?\nPlease comments for post:",
      "json_metadata": "{\"tags\":[\"hauntedgermany\",\"ghoststories\",\"mystery\",\"urbanlegends\"],\"image\":[\"https://cdn.steemitimages.com/DQmNUpt68PQKmZWjjmt7GNvz3UK8dxQAvRmf2gu9XsxoTuN/%23hauntedgermany.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "hauntedgermany",
      "permlink": "germany-s-most-haunted-places-will-give-you-chills",
      "title": "Germany's Most Haunted Places Will Give You Chills"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T18:38:21",
  "trx_id": "443ea6e95fed6f69dacb6398cab280b4747208a5",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:50:39
idcommunity
json["subscribe",{"community":"hive-108451"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562477/Trx 6c91a8cbce4906894bc237d95a38c8b0f1592d22
View Raw JSON Data
{
  "block": 106562477,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-108451\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:50:39",
  "trx_id": "6c91a8cbce4906894bc237d95a38c8b0f1592d22",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:50:30
idcommunity
json["unsubscribe",{"community":"hive-108451"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562474/Trx d60bc05be305a6716d3d581f2072437bf9904330
View Raw JSON Data
{
  "block": 106562474,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"unsubscribe\",{\"community\":\"hive-108451\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:50:30",
  "trx_id": "d60bc05be305a6716d3d581f2072437bf9904330",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/06/01 14:46:51
authorazeemgru
permlinkwrist-pain-symptoms-and-causes
voterazeemgru
weight0 (0.00%)
Transaction InfoBlock #106562401/Trx 154a175b321a86942dd054876e88894b2f62d859
View Raw JSON Data
{
  "block": 106562401,
  "op": [
    "vote",
    {
      "author": "azeemgru",
      "permlink": "wrist-pain-symptoms-and-causes",
      "voter": "azeemgru",
      "weight": 0
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:46:51",
  "trx_id": "154a175b321a86942dd054876e88894b2f62d859",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:45
idcommunity
json["subscribe",{"community":"hive-184714"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562379/Trx 2712ea94531bf54d08c466455bd33feda4d13b22
View Raw JSON Data
{
  "block": 106562379,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-184714\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:45",
  "trx_id": "2712ea94531bf54d08c466455bd33feda4d13b22",
  "trx_in_block": 1,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:42
idcommunity
json["subscribe",{"community":"hive-139150"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562378/Trx b7c32c41d5e4beff5ba7bdc500bc1eb317253ff6
View Raw JSON Data
{
  "block": 106562378,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-139150\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:42",
  "trx_id": "b7c32c41d5e4beff5ba7bdc500bc1eb317253ff6",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:30
idcommunity
json["subscribe",{"community":"hive-101145"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562374/Trx 02c7c2bc0895d0cbbb4437a784911f1a46f00a0f
View Raw JSON Data
{
  "block": 106562374,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-101145\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:30",
  "trx_id": "02c7c2bc0895d0cbbb4437a784911f1a46f00a0f",
  "trx_in_block": 5,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:27
idcommunity
json["subscribe",{"community":"hive-103599"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562373/Trx c1ab9ce07eecbb75a0fb6283e44199895972b2b3
View Raw JSON Data
{
  "block": 106562373,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-103599\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:27",
  "trx_id": "c1ab9ce07eecbb75a0fb6283e44199895972b2b3",
  "trx_in_block": 4,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:24
idcommunity
json["subscribe",{"community":"hive-166405"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562372/Trx 495efc58432a58d01d03c5526ad1669feb4fc961
View Raw JSON Data
{
  "block": 106562372,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-166405\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:24",
  "trx_id": "495efc58432a58d01d03c5526ad1669feb4fc961",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:18
idcommunity
json["subscribe",{"community":"hive-183369"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562370/Trx b00ba0601f3a62867391652e1df22ac11805b517
View Raw JSON Data
{
  "block": 106562370,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-183369\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:18",
  "trx_id": "b00ba0601f3a62867391652e1df22ac11805b517",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:15
idcommunity
json["subscribe",{"community":"hive-188619"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562369/Trx a9c040fb38b184e2bdadd59c35ce2a92f75c6927
View Raw JSON Data
{
  "block": 106562369,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-188619\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:15",
  "trx_id": "a9c040fb38b184e2bdadd59c35ce2a92f75c6927",
  "trx_in_block": 3,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:45:12
idcommunity
json["subscribe",{"community":"hive-144064"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562368/Trx 2544b2e8ba6e2e2202453149f463be967db6b4db
View Raw JSON Data
{
  "block": 106562368,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-144064\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:45:12",
  "trx_id": "2544b2e8ba6e2e2202453149f463be967db6b4db",
  "trx_in_block": 2,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:44:57
idcommunity
json["subscribe",{"community":"hive-183397"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562364/Trx 6bd2fbbf2d6ad327bc48de0c23d01c68109fed1e
View Raw JSON Data
{
  "block": 106562364,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-183397\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:44:57",
  "trx_id": "6bd2fbbf2d6ad327bc48de0c23d01c68109fed1e",
  "trx_in_block": 6,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:44:54
idcommunity
json["subscribe",{"community":"hive-196917"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562363/Trx 7afda733cb344a420a8c1a122fac866c0eadbc45
View Raw JSON Data
{
  "block": 106562363,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-196917\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:44:54",
  "trx_id": "7afda733cb344a420a8c1a122fac866c0eadbc45",
  "trx_in_block": 5,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:44:54
idcommunity
json["subscribe",{"community":"hive-150122"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562363/Trx f2dd5d675367b7934b938405b6f02769579cf033
View Raw JSON Data
{
  "block": 106562363,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-150122\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:44:54",
  "trx_id": "f2dd5d675367b7934b938405b6f02769579cf033",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:44:51
idcommunity
json["subscribe",{"community":"hive-150122"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562362/Trx 856bb171af7c41be867669fc8904fafa91dffcb6
View Raw JSON Data
{
  "block": 106562362,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-150122\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:44:51",
  "trx_id": "856bb171af7c41be867669fc8904fafa91dffcb6",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgrucustom json: community
2026/06/01 14:44:45
idcommunity
json["subscribe",{"community":"hive-129948"}]
required auths[]
required posting auths["azeemgru"]
Transaction InfoBlock #106562360/Trx 463663612de7404e0823471654f33d0f7771a26c
View Raw JSON Data
{
  "block": 106562360,
  "op": [
    "custom_json",
    {
      "id": "community",
      "json": "[\"subscribe\",{\"community\":\"hive-129948\"}]",
      "required_auths": [],
      "required_posting_auths": [
        "azeemgru"
      ]
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-06-01T14:44:45",
  "trx_id": "463663612de7404e0823471654f33d0f7771a26c",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/05/31 13:05:09
authorazeemgru
bodyHello every one
json metadata{"app":"steemit/0.2"}
parent authorazeemgru
parent permlinkwrist-pain-symptoms-and-causes
permlinktfvb6s
title
Transaction InfoBlock #106531686/Trx 781622f1fcc93e4d1bda42874d3bef5ff9ea2964
View Raw JSON Data
{
  "block": 106531686,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Hello every one",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "azeemgru",
      "parent_permlink": "wrist-pain-symptoms-and-causes",
      "permlink": "tfvb6s",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-31T13:05:09",
  "trx_id": "781622f1fcc93e4d1bda42874d3bef5ff9ea2964",
  "trx_in_block": 19,
  "virtual_op": 0
}
2026/05/31 13:04:21
authorazeemgru
permlinkwrist-pain-symptoms-and-causes
voterazeemgru
weight10000 (100.00%)
Transaction InfoBlock #106531670/Trx a074fc180b0279145e2461b0f4616c8a7a99ecc8
View Raw JSON Data
{
  "block": 106531670,
  "op": [
    "vote",
    {
      "author": "azeemgru",
      "permlink": "wrist-pain-symptoms-and-causes",
      "voter": "azeemgru",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-31T13:04:21",
  "trx_id": "a074fc180b0279145e2461b0f4616c8a7a99ecc8",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/05/31 09:06:15
authorazeemgru
bodyWrist pain: Symptoms and causes ![#wristinjuries.JPG](https://cdn.steemitimages.com/DQmaQPh6MrfJ4eVsQTAfcRJgCFNxTAV3MuzmNRZ2DhHcSv3/%23wristinjuries.JPG) (It is very inportent for health) People of (all ages) frequently have wrist injuries, but those who engage in repeated hand motions, work in offices, or are athletes are more vulnerable. A wrist sprain, which happens when the ligaments supporting the wrist are stretched or torn, sometimes as a result of falling on an outstretched hand, is one of the most common wrist ailments. (Wrist Sprain Symptoms) Typical indicators consist of: (Swelling and wrist pain) (Reduced range of motion due to bruising) (soreness in the vicinity of the joint) (How to Avoid Wrist Injuries) Before engaging in physical activity or sports, (warm up). When engaging in (physical activity), wear the appropriate safety equipment. When typing or doing monotonous chores, take regular rests. Increase the strength of your forearm and wrist muscles. (In conclusion) Despite the prevalence of wrist sprains, long-term problems can be avoided with prompt treatment and appropriate care. See a medical expert for a precise diagnosis and course of therapy if the pain or swelling doesn't go away. Visit here for more info: www.healthgru.com
json metadata{"tags":["wrist","injurieswristpain","health"],"image":["https://cdn.steemitimages.com/DQmaQPh6MrfJ4eVsQTAfcRJgCFNxTAV3MuzmNRZ2DhHcSv3/%23wristinjuries.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkwrist
permlinkwrist-pain-symptoms-and-causes
titleWrist pain: Symptoms and causes
Transaction InfoBlock #106526924/Trx 332b72e1c642e41af4548b069cb4652b264823cf
View Raw JSON Data
{
  "block": 106526924,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Wrist pain: Symptoms and causes\n\n![#wristinjuries.JPG](https://cdn.steemitimages.com/DQmaQPh6MrfJ4eVsQTAfcRJgCFNxTAV3MuzmNRZ2DhHcSv3/%23wristinjuries.JPG)\n\n(It is very inportent for health) People of (all ages) frequently have wrist injuries, but those who engage in repeated hand motions, work in offices, or are athletes are more vulnerable. A wrist sprain, which happens when the ligaments supporting the wrist are stretched or torn, sometimes as a result of falling on an outstretched hand, is one of the most common wrist ailments.\n\n(Wrist Sprain Symptoms)\nTypical indicators consist of:\n(Swelling and wrist pain)\n(Reduced range of motion due to bruising)\n(soreness in the vicinity of the joint)\n\n(How to Avoid Wrist Injuries)\nBefore engaging in physical activity or sports, (warm up).\nWhen engaging in (physical activity), wear the appropriate safety equipment.\nWhen typing or doing monotonous chores, take regular rests.\nIncrease the strength of your forearm and wrist muscles.\n\n(In conclusion)\nDespite the prevalence of wrist sprains, long-term problems can be avoided with prompt treatment and appropriate care. See a medical expert for a precise diagnosis and course of therapy if the pain or swelling doesn't go away.\n\nVisit here for more info: www.healthgru.com",
      "json_metadata": "{\"tags\":[\"wrist\",\"injurieswristpain\",\"health\"],\"image\":[\"https://cdn.steemitimages.com/DQmaQPh6MrfJ4eVsQTAfcRJgCFNxTAV3MuzmNRZ2DhHcSv3/%23wristinjuries.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "wrist",
      "permlink": "wrist-pain-symptoms-and-causes",
      "title": "Wrist pain: Symptoms and causes"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-31T09:06:15",
  "trx_id": "332b72e1c642e41af4548b069cb4652b264823cf",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/05/30 18:07:00
authortasonya
permlink3ypjd3-art-mehndi-design
voterazeemgru
weight10000 (100.00%)
Transaction InfoBlock #106509007/Trx 7411025d76922eb390e746757cbed592b5f65f1b
View Raw JSON Data
{
  "block": 106509007,
  "op": [
    "vote",
    {
      "author": "tasonya",
      "permlink": "3ypjd3-art-mehndi-design",
      "voter": "azeemgru",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T18:07:00",
  "trx_id": "7411025d76922eb390e746757cbed592b5f65f1b",
  "trx_in_block": 2,
  "virtual_op": 0
}
2026/05/30 18:05:09
authorazeemgru
bodyFitness and Diet Plan for Girls ![Fitnessdietplan.JPG](https://cdn.steemitimages.com/DQmPssLboVYmwve3W1Ybgak2heR8TjuqxQaFpRGCmVK6Pz7/Fitnessdietplan.JPG) Maintaining a healthy diet and staying in shape is more than just looking good: it's about feeling strong, confident, and full of energy every single day. A well rounded exercise regimen with a sensible nutrition plan can significantly improve a (girl's general health), mood, and self esteem. You don't need any pricey equipment or rigorous dieting to follow this simple and effective advice. Advantages of a Healthy Diet and Exercise Program raises vitality levels promotes hormone equilibrium strengthens bones and muscles and enhances skin health helps keep a healthy weight. lessens tension and worry Easy Exercise Program for Women 1. Get warm five minutes: To avoid injuries, always begin with a warm up: (running lightly on the spot) (Arm motions) (Swinging legs) (Breathing deeply) 2. 15 to 20 minutes of full body exercise: (Lower Body) (15 Reps of Squats) (12 lunges for each leg) (20 reps of glute bridges) (Upper Limbs) (Push ups (modified or complete) Reps 10 to 12) (Do ten tricep dips) (Abs (core) (30 second planking) (20 reps of bicycle crunches) (15 reps of leg raises) Do the entire routine twice or three times. 3. Take a 3 to 5 minute break: Extend your back, arms, and legs. Breathe deeply to ease tense muscles. Girls' Healthy Diet Plan Strong immunity, radiant skin, and a toned figure all depend on a balanced diet. Breakfast (Healthy Beginning) (Fruit and oatmeal) (Greek yogurt or a boiled egg) (Peanut butter and whole grain bread) (Snack in the middle of the morning) (Nuts, bananas, or apples) (Any seasonal, fresh fruit) Lunch (light and energizing) (Boiling lentils or grilled chicken) (Whole wheat rotis or brown rice) (Cucumber, tomato, and carrot based fresh salad) (Evening Munchie) Lemon water or green tea? (Roasted chana or a handful of almonds) (Dinner (clean and light) (Soup made with vegetables) (Steamed veggies, fish, or chicken) or a handmade curry with one or two chapatis Hydrating Advice: Fitness and Diet For natural electrolytes, consume six to eight glasses of water each day. Steer clear of junk food, sweets, and soda. Extra Advice for Women: 7 to 8 hours of sleep every day Practice yoga or meditation to reduce stress. Take tiny steps. Perfection is not as important as consistency. Pay attention to your body and don't overtrain.
json metadata{"tags":["fitnessdietplanhealthy"],"image":["https://cdn.steemitimages.com/DQmPssLboVYmwve3W1Ybgak2heR8TjuqxQaFpRGCmVK6Pz7/Fitnessdietplan.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkfitnessdietplanhealthy
permlinkfitness-and-diet-plan-for-girls
titleFitness and Diet Plan for Girls
Transaction InfoBlock #106508971/Trx 14da59da86b23491118e7a4f3845461e0d29b012
View Raw JSON Data
{
  "block": 106508971,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Fitness and Diet Plan for Girls\n\n![Fitnessdietplan.JPG](https://cdn.steemitimages.com/DQmPssLboVYmwve3W1Ybgak2heR8TjuqxQaFpRGCmVK6Pz7/Fitnessdietplan.JPG)\n\nMaintaining a healthy diet and staying in shape is more than just looking good: it's about feeling strong, confident, and full of energy every single day. A well rounded exercise regimen with a sensible nutrition plan can significantly improve a (girl's general health), mood, and self esteem. You don't need any pricey equipment or rigorous dieting to follow this simple and effective advice. \nAdvantages of a Healthy Diet and Exercise Program raises vitality levels promotes hormone equilibrium strengthens bones and muscles and enhances skin health helps keep a healthy weight. \nlessens tension and worry \nEasy Exercise Program for Women\n\n 1. Get warm five minutes: \nTo avoid injuries, always begin with a warm up:\n(running lightly on the spot) \n(Arm motions)\n(Swinging legs)\n(Breathing deeply)\n\n 2. 15 to 20 minutes of full body exercise:\n(Lower Body) \n(15 Reps of Squats)\n(12 lunges for each leg)\n(20 reps of glute bridges)\n(Upper Limbs)\n(Push ups (modified or complete) Reps 10 to 12)\n(Do ten tricep dips)\n(Abs (core)\n(30 second planking)\n(20 reps of bicycle crunches)\n(15 reps of leg raises)\nDo the entire routine twice or three times.\n\n3. Take a 3 to 5 minute break: \nExtend your back, arms, and legs.\nBreathe deeply to ease tense muscles. \nGirls' Healthy Diet Plan \nStrong immunity, radiant skin, and a toned figure all depend on a balanced diet.\n\nBreakfast (Healthy Beginning) \n(Fruit and oatmeal)\n(Greek yogurt or a boiled egg) \n(Peanut butter and whole grain bread) \n(Snack in the middle of the morning) \n(Nuts, bananas, or apples) \n(Any seasonal, fresh fruit) \nLunch (light and energizing)\n(Boiling lentils or grilled chicken)\n(Whole wheat rotis or brown rice)\n(Cucumber, tomato, and carrot based fresh salad)\n(Evening Munchie)\n\nLemon water or green tea?\n(Roasted chana or a handful of almonds)\n(Dinner (clean and light)\n(Soup made with vegetables)\n(Steamed veggies, fish, or chicken)\nor a handmade curry with one or two chapatis\n\nHydrating Advice: Fitness and Diet\nFor natural electrolytes, consume six to eight glasses of water each day. \nSteer clear of junk food, sweets, and soda. \nExtra Advice for Women: \n7 to 8 hours of sleep every day \nPractice yoga or meditation to reduce stress. \nTake tiny steps. Perfection is not as important as consistency. \nPay attention to your body and don't overtrain.",
      "json_metadata": "{\"tags\":[\"fitnessdietplanhealthy\"],\"image\":[\"https://cdn.steemitimages.com/DQmPssLboVYmwve3W1Ybgak2heR8TjuqxQaFpRGCmVK6Pz7/Fitnessdietplan.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "fitnessdietplanhealthy",
      "permlink": "fitness-and-diet-plan-for-girls",
      "title": "Fitness and Diet Plan for Girls"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T18:05:09",
  "trx_id": "14da59da86b23491118e7a4f3845461e0d29b012",
  "trx_in_block": 9,
  "virtual_op": 0
}
azeemgruupdated their account properties
2026/05/30 16:30:15
accountazeemgru
extensions[]
json metadata
posting json metadata{"profile":{"profile_image":"https://cdn.steemitimages.com/DQmbhaHnKRueqc4xQSMyQpBrz4cw9CiGGeU4JY4XXGBzZgH/Ladies%20Brands.png","cover_image":"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png","name":"Azeem Sarwar","about":"i am a content writer,","version":2,"location":"Pakistan"}}
Transaction InfoBlock #106507082/Trx 7b3600c4b37291c2b699c2b936a9617fad0d5f82
View Raw JSON Data
{
  "block": 106507082,
  "op": [
    "account_update2",
    {
      "account": "azeemgru",
      "extensions": [],
      "json_metadata": "",
      "posting_json_metadata": "{\"profile\":{\"profile_image\":\"https://cdn.steemitimages.com/DQmbhaHnKRueqc4xQSMyQpBrz4cw9CiGGeU4JY4XXGBzZgH/Ladies%20Brands.png\",\"cover_image\":\"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png\",\"name\":\"Azeem Sarwar\",\"about\":\"i am a  content writer,\",\"version\":2,\"location\":\"Pakistan\"}}"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T16:30:15",
  "trx_id": "7b3600c4b37291c2b699c2b936a9617fad0d5f82",
  "trx_in_block": 21,
  "virtual_op": 0
}
2026/05/30 16:28:15
authorazeemgru
bodyplease vote me
json metadata{"app":"steemit/0.2"}
parent authorselina75
parent permlink6sariu
permlinktfth06
title
Transaction InfoBlock #106507042/Trx 7abc1b35b4a7ba867a447c1feb6045438c8dd78e
View Raw JSON Data
{
  "block": 106507042,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "please vote me",
      "json_metadata": "{\"app\":\"steemit/0.2\"}",
      "parent_author": "selina75",
      "parent_permlink": "6sariu",
      "permlink": "tfth06",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T16:28:15",
  "trx_id": "7abc1b35b4a7ba867a447c1feb6045438c8dd78e",
  "trx_in_block": 0,
  "virtual_op": 0
}
azeemgruupvoted (100.00%) @selina75 / 6sariu
2026/05/30 16:27:24
authorselina75
permlink6sariu
voterazeemgru
weight10000 (100.00%)
Transaction InfoBlock #106507025/Trx 4ad13dd1a2b6a00df5a67b2a38b264038245a1fb
View Raw JSON Data
{
  "block": 106507025,
  "op": [
    "vote",
    {
      "author": "selina75",
      "permlink": "6sariu",
      "voter": "azeemgru",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T16:27:24",
  "trx_id": "4ad13dd1a2b6a00df5a67b2a38b264038245a1fb",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/05/30 16:21:00
authorazeemgru
permlinkhow-to-remove-face-wrinkles
voterazeemgru
weight0 (0.00%)
Transaction InfoBlock #106506898/Trx 3744c27f48ec9971de76be51d739ce7aac19c5a7
View Raw JSON Data
{
  "block": 106506898,
  "op": [
    "vote",
    {
      "author": "azeemgru",
      "permlink": "how-to-remove-face-wrinkles",
      "voter": "azeemgru",
      "weight": 0
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T16:21:00",
  "trx_id": "3744c27f48ec9971de76be51d739ce7aac19c5a7",
  "trx_in_block": 0,
  "virtual_op": 0
}
2026/05/30 16:20:06
authorazeemgru
bodyProfessional AI Content Writing Services ![#contentwriter.JPG](https://cdn.steemitimages.com/DQmaaW8NrP2AUKvQuLARqD9vt74rRdWADyu96SDE63fDyFn/%23contentwriter.JPG) Are you looking for high-quality, unique, and engaging content? (I offer professional AI-powered content writing services for) ✅ Blog Posts & Articles ✅ Health & Fitness Content ✅ SEO-Friendly Website Content ✅ Product Descriptions ✅ Social Media Posts ✅ Affiliate Marketing Content ✅ Steemit Articles ✅ Rewriting & Proofreading ✨ What You Get: 100% Unique Content SEO Optimized Articles Fast Delivery Affordable Rates Professional Quality (Contact Us) 📱 WhatsApp: 03422910770 📧 Email: [email protected]
json metadata{"tags":["contentwriter","blogwriting"],"image":["https://cdn.steemitimages.com/DQmaaW8NrP2AUKvQuLARqD9vt74rRdWADyu96SDE63fDyFn/%23contentwriter.JPG"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinkcontentwriter
permlinkprofessional-ai-content-writing-services
titleProfessional AI Content Writing Services
Transaction InfoBlock #106506881/Trx 824801e94654f47428640680cf9d9e4d041f7c9b
View Raw JSON Data
{
  "block": 106506881,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "Professional AI Content Writing Services\n\n![#contentwriter.JPG](https://cdn.steemitimages.com/DQmaaW8NrP2AUKvQuLARqD9vt74rRdWADyu96SDE63fDyFn/%23contentwriter.JPG)\n\nAre you looking for high-quality, unique, and engaging content?\n(I offer professional AI-powered content writing services for)\n✅ Blog Posts & Articles\n✅ Health & Fitness Content\n✅ SEO-Friendly Website Content\n✅ Product Descriptions\n✅ Social Media Posts\n✅ Affiliate Marketing Content\n✅ Steemit Articles\n✅ Rewriting & Proofreading\n✨ What You Get:\n100% Unique Content\nSEO Optimized Articles\nFast Delivery\nAffordable Rates\nProfessional Quality\n(Contact Us)\n📱 WhatsApp: 03422910770\n📧 Email: [email protected]",
      "json_metadata": "{\"tags\":[\"contentwriter\",\"blogwriting\"],\"image\":[\"https://cdn.steemitimages.com/DQmaaW8NrP2AUKvQuLARqD9vt74rRdWADyu96SDE63fDyFn/%23contentwriter.JPG\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "contentwriter",
      "permlink": "professional-ai-content-writing-services",
      "title": "Professional AI Content Writing Services"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T16:20:06",
  "trx_id": "824801e94654f47428640680cf9d9e4d041f7c9b",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/05/30 15:55:36
authorsnehaqorsage
permlinksteal-the-spotlight-with-the-annie-mini-dress-or-qorsage-usa
voterazeemgru
weight10000 (100.00%)
Transaction InfoBlock #106506393/Trx b4e7a2181a3d9423d76d75ba2ae57cb3496ac180
View Raw JSON Data
{
  "block": 106506393,
  "op": [
    "vote",
    {
      "author": "snehaqorsage",
      "permlink": "steal-the-spotlight-with-the-annie-mini-dress-or-qorsage-usa",
      "voter": "azeemgru",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T15:55:36",
  "trx_id": "b4e7a2181a3d9423d76d75ba2ae57cb3496ac180",
  "trx_in_block": 1,
  "virtual_op": 0
}
2026/05/30 15:52:24
authorazeemgru
bodySteemitCrypto: ![ChatGPT Image May 30, 2026, 01_16_33 AM.png](https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png) (SteemitCrypto) is an expanding community where members may exchange ideas, experiences, and expertise about blockchain technology and (cryptocurrencies). By fusing blockchain rewards with social networking, it enables users to obtain digital tokens for producing worthwhile content and interacting with the community. Discussions about Bitcoin, altcoins, decentralized finance (DeFi), (NFTs), and the newest developments in the (cryptocurrency) space are encouraged on the site. Article publishing, commenting, and upvoting other creators are all possible for users. (SteemitCrypto's) ability to reward (high quality) content is one of its main advantages, which attracts bloggers, investors, and cryptocurrency aficionados. Members can earn cryptocurrency incentives and develop their reputation by sharing helpful information and remaining active. Platforms like (SteemitCrypto) give people all around the world the chance to learn, connect, and profit from the growing digital economy as blockchain technology advances. Visit here @azeemgru
json metadata{"tags":["steemitcryptoblockchain"],"users":["azeemgru"],"image":["https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png"],"app":"steemit/0.2","format":"markdown"}
parent author
parent permlinksteemitcryptoblockchain
permlinksteemitcrypto-a-platform-for-crypto-enthusiasts
titleSteemitCrypto: A Platform for Crypto Enthusiasts
Transaction InfoBlock #106506329/Trx ff0b401f09d2baf03b629d17347ad7ea50042977
View Raw JSON Data
{
  "block": 106506329,
  "op": [
    "comment",
    {
      "author": "azeemgru",
      "body": "SteemitCrypto:\n\n![ChatGPT Image May 30, 2026, 01_16_33 AM.png](https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png)\n\n(SteemitCrypto) is an expanding community where members may exchange ideas, experiences, and expertise about blockchain technology and (cryptocurrencies). By fusing blockchain rewards with social networking, it enables users to obtain digital tokens for producing worthwhile content and interacting with the community.\n\nDiscussions about Bitcoin, altcoins, decentralized finance (DeFi), (NFTs), and the newest developments in the (cryptocurrency) space are encouraged on the site. Article publishing, commenting, and upvoting other creators are all possible for users.\n\n(SteemitCrypto's) ability to reward (high quality) content is one of its main advantages, which attracts bloggers, investors, and cryptocurrency aficionados. Members can earn cryptocurrency incentives and develop their reputation by sharing helpful information and remaining active.\n\nPlatforms like (SteemitCrypto) give people all around the world the chance to learn, connect, and profit from the growing digital economy as blockchain technology advances.\n\nVisit here @azeemgru",
      "json_metadata": "{\"tags\":[\"steemitcryptoblockchain\"],\"users\":[\"azeemgru\"],\"image\":[\"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png\"],\"app\":\"steemit/0.2\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "steemitcryptoblockchain",
      "permlink": "steemitcrypto-a-platform-for-crypto-enthusiasts",
      "title": "SteemitCrypto: A Platform for Crypto Enthusiasts"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2026-05-30T15:52:24",
  "trx_id": "ff0b401f09d2baf03b629d17347ad7ea50042977",
  "trx_in_block": 0,
  "virtual_op": 0
}

Account Metadata

POSTING JSON METADATA
profile{"profile_image":"https://cdn.steemitimages.com/DQmSffJ4CLyhWjtK3XxJ1jWvQPjGZzASBymqtjZ8FnUxGr7/ChatGPT%20Image%20Jun%205,%202026,%2001_28_12%20AM.png","cover_image":"https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png","name":"Azeem Sarwar","about":"i am a content writer,","version":2,"location":"Pakistan"}
JSON METADATA
None
{
  "posting_json_metadata": {
    "profile": {
      "profile_image": "https://cdn.steemitimages.com/DQmSffJ4CLyhWjtK3XxJ1jWvQPjGZzASBymqtjZ8FnUxGr7/ChatGPT%20Image%20Jun%205,%202026,%2001_28_12%20AM.png",
      "cover_image": "https://cdn.steemitimages.com/DQmYMfr17B2Ed3Eazj38wNFGhFDX9HAjdNpNS3wLBft8jT6/ChatGPT%20Image%20May%2030,%202026,%2001_16_33%20AM.png",
      "name": "Azeem Sarwar",
      "about": "i am a  content writer,",
      "version": 2,
      "location": "Pakistan"
    }
  },
  "json_metadata": {}
}

Auth Keys

Owner
Single Signature
Public Keys
STM52dbC2FD48nLxceWmARiGTzZQgDCUZA4apRJKZb6wiXDdUDMya1/1
Active
Single Signature
Public Keys
STM4zhs7gBqfU2EvsjFMertqC2iWdedVBazaGG7h5hHhLWWLdaXHc1/1
Posting
Single Signature
Public Keys
STM7gqZT1H7YFgmnRYPY2jnpGvpFUbxX7KqywNrG2NezD2RFDFf9G1/1
Memo
STM7v4tK3oHeCDM1C2tvo7QV7oxYZyVoxUDMmfLhcW7fpxEy4PXx9
{
  "owner": {
    "account_auths": [],
    "key_auths": [
      [
        "STM52dbC2FD48nLxceWmARiGTzZQgDCUZA4apRJKZb6wiXDdUDMya",
        1
      ]
    ],
    "weight_threshold": 1
  },
  "active": {
    "account_auths": [],
    "key_auths": [
      [
        "STM4zhs7gBqfU2EvsjFMertqC2iWdedVBazaGG7h5hHhLWWLdaXHc",
        1
      ]
    ],
    "weight_threshold": 1
  },
  "posting": {
    "account_auths": [],
    "key_auths": [
      [
        "STM7gqZT1H7YFgmnRYPY2jnpGvpFUbxX7KqywNrG2NezD2RFDFf9G",
        1
      ]
    ],
    "weight_threshold": 1
  },
  "memo": "STM7v4tK3oHeCDM1C2tvo7QV7oxYZyVoxUDMmfLhcW7fpxEy4PXx9"
}

Witness Votes

1 / 30
[
  "bangla.witness"
]