VOTING POWER100.00%
DOWNVOTE POWER100.00%
RESOURCE CREDITS100.00%
REPUTATION PROGRESS39.39%
Net Worth
0.291USD
STEEM
0.000STEEM
SBD
0.503SBD
Effective Power
5.001SP
├── Own SP
0.794SP
└── Incoming DelegationsDeleg
+4.207SP
Detailed Balance
| STEEM | ||
| balance | 0.000STEEM | STEEM |
| market_balance | 0.000STEEM | STEEM |
| savings_balance | 0.000STEEM | STEEM |
| reward_steem_balance | 0.000STEEM | STEEM |
| STEEM POWER | ||
| Own SP | 0.794SP | SP |
| Delegated Out | 0.000SP | SP |
| Delegation In | 4.207SP | SP |
| Effective Power | 5.001SP | SP |
| Reward SP (pending) | 0.000SP | SP |
| SBD | ||
| sbd_balance | 0.503SBD | SBD |
| sbd_conversions | 0.000SBD | SBD |
| sbd_market_balance | 0.000SBD | SBD |
| savings_sbd_balance | 0.000SBD | SBD |
| reward_sbd_balance | 0.000SBD | SBD |
{
"balance": "0.000 STEEM",
"savings_balance": "0.000 STEEM",
"reward_steem_balance": "0.000 STEEM",
"vesting_shares": "1293.484317 VESTS",
"delegated_vesting_shares": "0.000000 VESTS",
"received_vesting_shares": "6850.175489 VESTS",
"sbd_balance": "0.503 SBD",
"savings_sbd_balance": "0.000 SBD",
"reward_sbd_balance": "0.000 SBD",
"conversions": []
}Account Info
| name | spayk |
| id | 640514 |
| rank | 663,034 |
| reputation | 3077573287 |
| created | 2018-01-23T13:07:39 |
| recovery_account | steem |
| proxy | None |
| post_count | 29 |
| comment_count | 0 |
| lifetime_vote_count | 0 |
| witnesses_voted_for | 0 |
| last_post | 2018-02-05T14:15:21 |
| last_root_post | 2018-02-05T14:15:21 |
| last_vote_time | 2018-04-21T12:24:21 |
| proxied_vsf_votes | 0, 0, 0, 0 |
| can_vote | 1 |
| voting_power | 0 |
| delayed_votes | 0 |
| balance | 0.000 STEEM |
| savings_balance | 0.000 STEEM |
| sbd_balance | 0.503 SBD |
| savings_sbd_balance | 0.000 SBD |
| vesting_shares | 1293.484317 VESTS |
| delegated_vesting_shares | 0.000000 VESTS |
| received_vesting_shares | 6850.175489 VESTS |
| reward_vesting_balance | 0.000000 VESTS |
| vesting_balance | 0.000 STEEM |
| vesting_withdraw_rate | 0.000000 VESTS |
| next_vesting_withdrawal | 1969-12-31T23:59:59 |
| withdrawn | 0 |
| to_withdraw | 0 |
| withdraw_routes | 0 |
| savings_withdraw_requests | 0 |
| last_account_recovery | 1970-01-01T00:00:00 |
| reset_account | null |
| last_owner_update | 1970-01-01T00:00:00 |
| last_account_update | 2018-01-30T21:16:03 |
| mined | No |
| sbd_seconds | 205,483,554 |
| sbd_last_interest_payment | 2018-02-02T18:21:03 |
| savings_sbd_last_interest_payment | 1970-01-01T00:00:00 |
{
"id": 640514,
"name": "spayk",
"owner": {
"weight_threshold": 1,
"account_auths": [],
"key_auths": [
[
"STM7rwM3ikC5cCYgUTmSMKsy4ShSw9BTmFTPgHrsatTHE4FF8pfue",
1
]
]
},
"active": {
"weight_threshold": 1,
"account_auths": [],
"key_auths": [
[
"STM6eTivYLQTJi8DRBksTSRk3DGoQWHxdcqVDYZLTs3qF7Px16ajm",
1
]
]
},
"posting": {
"weight_threshold": 1,
"account_auths": [],
"key_auths": [
[
"STM7156iPcLdi2dNgvSYRy8gJ4tuMsEJDJpEVFQxwkjaw2QPMvxDe",
1
]
]
},
"memo_key": "STM7d78LqSCMLHGw4N8pbHSKaZARbzayYqdspmLXG4pWicxeZo4dS",
"json_metadata": "{\"profile\":{\"location\":\"Krakow\",\"profile_image\":\"https://i.imgur.com/CbZy8qw.png\"}}",
"posting_json_metadata": "{\"profile\":{\"location\":\"Krakow\",\"profile_image\":\"https://i.imgur.com/CbZy8qw.png\"}}",
"proxy": "",
"last_owner_update": "1970-01-01T00:00:00",
"last_account_update": "2018-01-30T21:16:03",
"created": "2018-01-23T13:07:39",
"mined": false,
"recovery_account": "steem",
"last_account_recovery": "1970-01-01T00:00:00",
"reset_account": "null",
"comment_count": 0,
"lifetime_vote_count": 0,
"post_count": 29,
"can_vote": true,
"voting_manabar": {
"current_mana": "8143659806",
"last_update_time": 1779086826
},
"downvote_manabar": {
"current_mana": 2035914951,
"last_update_time": 1779086826
},
"voting_power": 0,
"balance": "0.000 STEEM",
"savings_balance": "0.000 STEEM",
"sbd_balance": "0.503 SBD",
"sbd_seconds": "205483554",
"sbd_seconds_last_update": "2018-02-09T18:32:21",
"sbd_last_interest_payment": "2018-02-02T18:21:03",
"savings_sbd_balance": "0.000 SBD",
"savings_sbd_seconds": "0",
"savings_sbd_seconds_last_update": "1970-01-01T00:00:00",
"savings_sbd_last_interest_payment": "1970-01-01T00:00:00",
"savings_withdraw_requests": 0,
"reward_sbd_balance": "0.000 SBD",
"reward_steem_balance": "0.000 STEEM",
"reward_vesting_balance": "0.000000 VESTS",
"reward_vesting_steem": "0.000 STEEM",
"vesting_shares": "1293.484317 VESTS",
"delegated_vesting_shares": "0.000000 VESTS",
"received_vesting_shares": "6850.175489 VESTS",
"vesting_withdraw_rate": "0.000000 VESTS",
"next_vesting_withdrawal": "1969-12-31T23:59:59",
"withdrawn": 0,
"to_withdraw": 0,
"withdraw_routes": 0,
"curation_rewards": 1,
"posting_rewards": 242,
"proxied_vsf_votes": [
0,
0,
0,
0
],
"witnesses_voted_for": 0,
"last_post": "2018-02-05T14:15:21",
"last_root_post": "2018-02-05T14:15:21",
"last_vote_time": "2018-04-21T12:24:21",
"post_bandwidth": 0,
"pending_claimed_accounts": 0,
"vesting_balance": "0.000 STEEM",
"reputation": 3077573287,
"transfer_history": [],
"market_history": [],
"post_history": [],
"vote_history": [],
"other_history": [],
"witness_votes": [],
"tags_usage": [],
"guest_bloggers": [],
"rank": 663034
}Withdraw Routes
| Incoming | Outgoing |
|---|---|
Empty | Empty |
{
"incoming": [],
"outgoing": []
}From Date
To Date
2026/05/18 06:47:06
2026/05/18 06:47:06
| delegator | steem |
| delegatee | spayk |
| vesting shares | 6850.175489 VESTS |
| Transaction Info | Block #106151253/Trx 7b514595b7688d4ab45a8ac460d7fcb4ed6b0abf |
View Raw JSON Data
{
"trx_id": "7b514595b7688d4ab45a8ac460d7fcb4ed6b0abf",
"block": 106151253,
"trx_in_block": 0,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2026-05-18T06:47:06",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "6850.175489 VESTS"
}
]
}2026/05/13 06:25:12
2026/05/13 06:25:12
| delegator | steem |
| delegatee | spayk |
| vesting shares | 4137.965084 VESTS |
| Transaction Info | Block #106007532/Trx 0eb9a6a413f73fa27d0aade2c42222f8652f02df |
View Raw JSON Data
{
"trx_id": "0eb9a6a413f73fa27d0aade2c42222f8652f02df",
"block": 106007532,
"trx_in_block": 2,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2026-05-13T06:25:12",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "4137.965084 VESTS"
}
]
}2026/04/26 05:58:09
2026/04/26 05:58:09
| delegator | steem |
| delegatee | spayk |
| vesting shares | 6862.691245 VESTS |
| Transaction Info | Block #105518723/Trx 312fae71e277b5b83d562cfa205c7249026fad69 |
View Raw JSON Data
{
"trx_id": "312fae71e277b5b83d562cfa205c7249026fad69",
"block": 105518723,
"trx_in_block": 0,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2026-04-26T05:58:09",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "6862.691245 VESTS"
}
]
}2026/01/24 01:24:06
2026/01/24 01:24:06
| delegator | steem |
| delegatee | spayk |
| vesting shares | 4179.511903 VESTS |
| Transaction Info | Block #102872893/Trx 8acf6772a3e1ce6a0dadc499d965b6bc6c839c06 |
View Raw JSON Data
{
"trx_id": "8acf6772a3e1ce6a0dadc499d965b6bc6c839c06",
"block": 102872893,
"trx_in_block": 4,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2026-01-24T01:24:06",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "4179.511903 VESTS"
}
]
}2024/12/17 20:33:39
2024/12/17 20:33:39
| delegator | steem |
| delegatee | spayk |
| vesting shares | 4343.731100 VESTS |
| Transaction Info | Block #91319100/Trx cb4b61d0dce4e1a9f667ebfd232e69c8ca889a88 |
View Raw JSON Data
{
"trx_id": "cb4b61d0dce4e1a9f667ebfd232e69c8ca889a88",
"block": 91319100,
"trx_in_block": 5,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2024-12-17T20:33:39",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "4343.731100 VESTS"
}
]
}2023/11/14 12:14:06
2023/11/14 12:14:06
| delegator | steem |
| delegatee | spayk |
| vesting shares | 4512.864632 VESTS |
| Transaction Info | Block #79873230/Trx bc2d5d2c7b97d6084713eb1d060099d73a13c281 |
View Raw JSON Data
{
"trx_id": "bc2d5d2c7b97d6084713eb1d060099d73a13c281",
"block": 79873230,
"trx_in_block": 3,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2023-11-14T12:14:06",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "4512.864632 VESTS"
}
]
}2023/09/22 10:59:30
2023/09/22 10:59:30
| delegator | steem |
| delegatee | spayk |
| vesting shares | 7449.773418 VESTS |
| Transaction Info | Block #78363583/Trx 424708348d1190d26350f2a4180698dae3ba0ab5 |
View Raw JSON Data
{
"trx_id": "424708348d1190d26350f2a4180698dae3ba0ab5",
"block": 78363583,
"trx_in_block": 2,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2023-09-22T10:59:30",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "7449.773418 VESTS"
}
]
}2022/11/03 18:22:27
2022/11/03 18:22:27
| delegator | steem |
| delegatee | spayk |
| vesting shares | 7671.824856 VESTS |
| Transaction Info | Block #69121228/Trx a2e95945b27cd9e5039ebd86337ff3fbfd763acc |
View Raw JSON Data
{
"trx_id": "a2e95945b27cd9e5039ebd86337ff3fbfd763acc",
"block": 69121228,
"trx_in_block": 9,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2022-11-03T18:22:27",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "7671.824856 VESTS"
}
]
}2022/01/17 23:31:21
2022/01/17 23:31:21
| delegator | steem |
| delegatee | spayk |
| vesting shares | 7891.932457 VESTS |
| Transaction Info | Block #60824419/Trx 3b761322a4575de4ad69323cf83891876b138ff0 |
View Raw JSON Data
{
"trx_id": "3b761322a4575de4ad69323cf83891876b138ff0",
"block": 60824419,
"trx_in_block": 24,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2022-01-17T23:31:21",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "7891.932457 VESTS"
}
]
}2021/06/14 06:40:48
2021/06/14 06:40:48
| delegator | steem |
| delegatee | spayk |
| vesting shares | 8076.126745 VESTS |
| Transaction Info | Block #54614713/Trx 37932f00c0870c31e99f38e0a9e216cca9a528a8 |
View Raw JSON Data
{
"trx_id": "37932f00c0870c31e99f38e0a9e216cca9a528a8",
"block": 54614713,
"trx_in_block": 2,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2021-06-14T06:40:48",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "8076.126745 VESTS"
}
]
}2020/12/11 16:52:36
2020/12/11 16:52:36
| delegator | steem |
| delegatee | spayk |
| vesting shares | 8263.548719 VESTS |
| Transaction Info | Block #49361960/Trx f172a0bf16fe30deb0a45758eb8128b72380e2bd |
View Raw JSON Data
{
"trx_id": "f172a0bf16fe30deb0a45758eb8128b72380e2bd",
"block": 49361960,
"trx_in_block": 0,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-12-11T16:52:36",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "8263.548719 VESTS"
}
]
}2020/12/06 10:28:03
2020/12/06 10:28:03
| delegator | steem |
| delegatee | spayk |
| vesting shares | 1912.543513 VESTS |
| Transaction Info | Block #49213474/Trx 9ac66a872995fa5cf1a275ac58802ae3b440b59b |
View Raw JSON Data
{
"trx_id": "9ac66a872995fa5cf1a275ac58802ae3b440b59b",
"block": 49213474,
"trx_in_block": 0,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-12-06T10:28:03",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "1912.543513 VESTS"
}
]
}2020/12/05 20:30:24
2020/12/05 20:30:24
| delegator | steem |
| delegatee | spayk |
| vesting shares | 8269.756573 VESTS |
| Transaction Info | Block #49197045/Trx b4dd3a71ac83bfdf53f4af539585a647c1032b4c |
View Raw JSON Data
{
"trx_id": "b4dd3a71ac83bfdf53f4af539585a647c1032b4c",
"block": 49197045,
"trx_in_block": 7,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-12-05T20:30:24",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "8269.756573 VESTS"
}
]
}2020/11/03 03:37:45
2020/11/03 03:37:45
| delegator | steem |
| delegatee | spayk |
| vesting shares | 1920.017158 VESTS |
| Transaction Info | Block #48271916/Trx bb6a5312a75aa39ef5d8f2d6030ddf7843794f9b |
View Raw JSON Data
{
"trx_id": "bb6a5312a75aa39ef5d8f2d6030ddf7843794f9b",
"block": 48271916,
"trx_in_block": 1,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-11-03T03:37:45",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "1920.017158 VESTS"
}
]
}2020/05/09 11:31:42
2020/05/09 11:31:42
| delegator | steem |
| delegatee | spayk |
| vesting shares | 8472.561932 VESTS |
| Transaction Info | Block #43223813/Trx be2a6762cf8542e65637734d4f9edb16803aaf11 |
View Raw JSON Data
{
"trx_id": "be2a6762cf8542e65637734d4f9edb16803aaf11",
"block": 43223813,
"trx_in_block": 14,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-05-09T11:31:42",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "8472.561932 VESTS"
}
]
}2020/05/08 15:59:36
2020/05/08 15:59:36
| delegator | steem |
| delegatee | spayk |
| vesting shares | 1953.311140 VESTS |
| Transaction Info | Block #43200929/Trx 66bc8994e902fa49bb090c71ed609053025e1a3d |
View Raw JSON Data
{
"trx_id": "66bc8994e902fa49bb090c71ed609053025e1a3d",
"block": 43200929,
"trx_in_block": 24,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-05-08T15:59:36",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "1953.311140 VESTS"
}
]
}2020/01/23 14:15:27
2020/01/23 14:15:27
| parent author | spayk |
| parent permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| author | steemitboard |
| permlink | steemitboard-notify-spayk-20200123t141527000z |
| title | |
| body | Congratulations @spayk! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@spayk/birthday2.png</td><td>Happy Birthday! - You are on the Steem blockchain for 2 years!</td></tr></table> <sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@spayk) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=spayk)_</sub> ###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes! |
| json metadata | {"image":["https://steemitboard.com/img/notify.png"]} |
| Transaction Info | Block #40181786/Trx 6b35bfd01305f2b7fc38ef0244bbeadd2cb2abc5 |
View Raw JSON Data
{
"trx_id": "6b35bfd01305f2b7fc38ef0244bbeadd2cb2abc5",
"block": 40181786,
"trx_in_block": 24,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2020-01-23T14:15:27",
"op": [
"comment",
{
"parent_author": "spayk",
"parent_permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"author": "steemitboard",
"permlink": "steemitboard-notify-spayk-20200123t141527000z",
"title": "",
"body": "Congratulations @spayk! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@spayk/birthday2.png</td><td>Happy Birthday! - You are on the Steem blockchain for 2 years!</td></tr></table>\n\n<sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@spayk) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=spayk)_</sub>\n\n\n###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!",
"json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
}
]
}2019/07/10 11:05:54
2019/07/10 11:05:54
| delegator | steem |
| delegatee | spayk |
| vesting shares | 8646.964654 VESTS |
| Transaction Info | Block #34538080/Trx d9caca74dac2ea48e966caafad3633894635fe18 |
View Raw JSON Data
{
"trx_id": "d9caca74dac2ea48e966caafad3633894635fe18",
"block": 34538080,
"trx_in_block": 18,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2019-07-10T11:05:54",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "8646.964654 VESTS"
}
]
}2019/01/23 13:32:00
2019/01/23 13:32:00
| parent author | spayk |
| parent permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| author | steemitboard |
| permlink | steemitboard-notify-spayk-20190123t133159000z |
| title | |
| body | Congratulations @spayk! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@spayk/birthday1.png</td><td>Happy Birthday! - You are on the Steem blockchain for 1 year!</td></tr></table> <sub>_[Click here to view your Board](https://steemitboard.com/@spayk)_</sub> > Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**! |
| json metadata | {"image":["https://steemitboard.com/img/notify.png"]} |
| Transaction Info | Block #29708411/Trx a0c4b0f84d640de1c3df7fb6af6b9f1777c32256 |
View Raw JSON Data
{
"trx_id": "a0c4b0f84d640de1c3df7fb6af6b9f1777c32256",
"block": 29708411,
"trx_in_block": 5,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2019-01-23T13:32:00",
"op": [
"comment",
{
"parent_author": "spayk",
"parent_permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"author": "steemitboard",
"permlink": "steemitboard-notify-spayk-20190123t133159000z",
"title": "",
"body": "Congratulations @spayk! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@spayk/birthday1.png</td><td>Happy Birthday! - You are on the Steem blockchain for 1 year!</td></tr></table>\n\n<sub>_[Click here to view your Board](https://steemitboard.com/@spayk)_</sub>\n\n\n> Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!",
"json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
}
]
}2018/07/21 12:47:21
2018/07/21 12:47:21
| delegator | steem |
| delegatee | spayk |
| vesting shares | 8845.826913 VESTS |
| Transaction Info | Block #24370259/Trx 2e0111a854b5d5e8cc757dfd2ff34d52d06d94ce |
View Raw JSON Data
{
"trx_id": "2e0111a854b5d5e8cc757dfd2ff34d52d06d94ce",
"block": 24370259,
"trx_in_block": 44,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-07-21T12:47:21",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "8845.826913 VESTS"
}
]
}2018/05/29 06:14:06
2018/05/29 06:14:06
| delegator | steem |
| delegatee | spayk |
| vesting shares | 29209.399840 VESTS |
| Transaction Info | Block #22846950/Trx 4973ad2286fe20fb962329b1928ba25cdaa992e9 |
View Raw JSON Data
{
"trx_id": "4973ad2286fe20fb962329b1928ba25cdaa992e9",
"block": 22846950,
"trx_in_block": 21,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-05-29T06:14:06",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "29209.399840 VESTS"
}
]
}2018/04/21 12:24:21
2018/04/21 12:24:21
| voter | spayk |
| author | kungalu |
| permlink | strimi-wywiad-pastwo-vs-kryptowaluty-mentzen-dziej-si-absurdalne-rzeczy-20180420t201928924z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #21761178/Trx 1d3818cb7e6eda641ab3be00b1cf79c3f7564e69 |
View Raw JSON Data
{
"trx_id": "1d3818cb7e6eda641ab3be00b1cf79c3f7564e69",
"block": 21761178,
"trx_in_block": 27,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-04-21T12:24:21",
"op": [
"vote",
{
"voter": "spayk",
"author": "kungalu",
"permlink": "strimi-wywiad-pastwo-vs-kryptowaluty-mentzen-dziej-si-absurdalne-rzeczy-20180420t201928924z",
"weight": 10000
}
]
}2018/03/07 20:40:45
2018/03/07 20:40:45
| voter | spayk |
| author | gavin-guile |
| permlink | strimi-miso-wyhodowane-w-laboratorium-moe-trafi-do-sprzeday-jeszcze-w-tym-roku-20180307t191239861z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #20476459/Trx c7b0f1ea44b95d963626e3cda19c355c734b1e10 |
View Raw JSON Data
{
"trx_id": "c7b0f1ea44b95d963626e3cda19c355c734b1e10",
"block": 20476459,
"trx_in_block": 43,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-03-07T20:40:45",
"op": [
"vote",
{
"voter": "spayk",
"author": "gavin-guile",
"permlink": "strimi-miso-wyhodowane-w-laboratorium-moe-trafi-do-sprzeday-jeszcze-w-tym-roku-20180307t191239861z",
"weight": 10000
}
]
}2018/03/07 20:40:33
2018/03/07 20:40:33
| voter | spayk |
| author | tymcio |
| permlink | strimi-produktw-xiaomi-w-polsce-coraz-wicej-do-oferty-trafiaj-nowe-urzdzenia-gizchinacompl-20180307t193113206z |
| weight | 5000 (50.00%) |
| Transaction Info | Block #20476455/Trx 0e64e995dee4bd68bb6a7cbe895d764a6a6e4953 |
View Raw JSON Data
{
"trx_id": "0e64e995dee4bd68bb6a7cbe895d764a6a6e4953",
"block": 20476455,
"trx_in_block": 8,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-03-07T20:40:33",
"op": [
"vote",
{
"voter": "spayk",
"author": "tymcio",
"permlink": "strimi-produktw-xiaomi-w-polsce-coraz-wicej-do-oferty-trafiaj-nowe-urzdzenia-gizchinacompl-20180307t193113206z",
"weight": 5000
}
]
}spaykclaimed reward balance: 0.042 SBD, 0.015 SP2018/02/09 18:32:21
spaykclaimed reward balance: 0.042 SBD, 0.015 SP
2018/02/09 18:32:21
| account | spayk |
| reward steem | 0.000 STEEM |
| reward sbd | 0.042 SBD |
| reward vests | 24.543952 VESTS |
| Transaction Info | Block #19725704/Trx e965a04dc546bc0a389029647060edcb33a09d47 |
View Raw JSON Data
{
"trx_id": "e965a04dc546bc0a389029647060edcb33a09d47",
"block": 19725704,
"trx_in_block": 3,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-09T18:32:21",
"op": [
"claim_reward_balance",
{
"account": "spayk",
"reward_steem": "0.000 STEEM",
"reward_sbd": "0.042 SBD",
"reward_vests": "24.543952 VESTS"
}
]
}spaykreceived 0.042 SBD, 0.015 SP author reward for @spayk / re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z2018/02/07 18:21:15
spaykreceived 0.042 SBD, 0.015 SP author reward for @spayk / re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z
2018/02/07 18:21:15
| author | spayk |
| permlink | re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z |
| sbd payout | 0.042 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 24.543952 VESTS |
| Transaction Info | Block #19668122/Virtual Operation #15 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19668122,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 15,
"timestamp": "2018-02-07T18:21:15",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z",
"sbd_payout": "0.042 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "24.543952 VESTS"
}
]
}2018/02/06 13:27:12
2018/02/06 13:27:12
| delegator | steem |
| delegatee | spayk |
| vesting shares | 29412.779476 VESTS |
| Transaction Info | Block #19633482/Trx 358e2a3a592b92ade8efb8c6a603fe3bd51bde37 |
View Raw JSON Data
{
"trx_id": "358e2a3a592b92ade8efb8c6a603fe3bd51bde37",
"block": 19633482,
"trx_in_block": 10,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-06T13:27:12",
"op": [
"delegate_vesting_shares",
{
"delegator": "steem",
"delegatee": "spayk",
"vesting_shares": "29412.779476 VESTS"
}
]
}2018/02/06 11:47:30
2018/02/06 11:47:30
| voter | spayk |
| author | kargul09 |
| permlink | strimi-domy-na-sardynii-mona-kupi-za-1-euro-gdzie-jest-haczyk-20180205t165837222z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19631490/Trx 6c3cca8ef4f5400d1453bf35e7536667301ce5ee |
View Raw JSON Data
{
"trx_id": "6c3cca8ef4f5400d1453bf35e7536667301ce5ee",
"block": 19631490,
"trx_in_block": 59,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-06T11:47:30",
"op": [
"vote",
{
"voter": "spayk",
"author": "kargul09",
"permlink": "strimi-domy-na-sardynii-mona-kupi-za-1-euro-gdzie-jest-haczyk-20180205t165837222z",
"weight": 10000
}
]
}spaykclaimed reward balance: 0.183 SBD, 0.058 SP2018/02/06 11:47:09
spaykclaimed reward balance: 0.183 SBD, 0.058 SP
2018/02/06 11:47:09
| account | spayk |
| reward steem | 0.000 STEEM |
| reward sbd | 0.183 SBD |
| reward vests | 94.091435 VESTS |
| Transaction Info | Block #19631483/Trx b81cbd8f3a2a91b59325726ad0c7819a3ea0461c |
View Raw JSON Data
{
"trx_id": "b81cbd8f3a2a91b59325726ad0c7819a3ea0461c",
"block": 19631483,
"trx_in_block": 27,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-06T11:47:09",
"op": [
"claim_reward_balance",
{
"account": "spayk",
"reward_steem": "0.000 STEEM",
"reward_sbd": "0.183 SBD",
"reward_vests": "94.091435 VESTS"
}
]
}spaykreceived 0.183 SBD, 0.058 SP author reward for @spayk / strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z2018/02/06 11:11:51
spaykreceived 0.183 SBD, 0.058 SP author reward for @spayk / strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z
2018/02/06 11:11:51
| author | spayk |
| permlink | strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z |
| sbd payout | 0.183 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 94.091435 VESTS |
| Transaction Info | Block #19630777/Virtual Operation #5 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19630777,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 5,
"timestamp": "2018-02-06T11:11:51",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z",
"sbd_payout": "0.183 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "94.091435 VESTS"
}
]
}2018/02/06 11:11:51
2018/02/06 11:11:51
| benefactor | strimi |
| author | spayk |
| permlink | strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 32.727455 VESTS |
| Transaction Info | Block #19630777/Virtual Operation #4 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19630777,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 4,
"timestamp": "2018-02-06T11:11:51",
"op": [
"comment_benefactor_reward",
{
"benefactor": "strimi",
"author": "spayk",
"permlink": "strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "32.727455 VESTS"
}
]
}2018/02/05 16:06:45
2018/02/05 16:06:45
| voter | frywolnystrzelec |
| author | spayk |
| permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19607881/Trx 5217ead5f40a48102b1027ea3f97c1e20e19e2ff |
View Raw JSON Data
{
"trx_id": "5217ead5f40a48102b1027ea3f97c1e20e19e2ff",
"block": 19607881,
"trx_in_block": 23,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T16:06:45",
"op": [
"vote",
{
"voter": "frywolnystrzelec",
"author": "spayk",
"permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"weight": 10000
}
]
}2018/02/05 15:04:30
2018/02/05 15:04:30
| voter | gavin-guile |
| author | spayk |
| permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19606636/Trx 00a610a1660f8aadd76fd2f99ad5e64517ca32be |
View Raw JSON Data
{
"trx_id": "00a610a1660f8aadd76fd2f99ad5e64517ca32be",
"block": 19606636,
"trx_in_block": 39,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T15:04:30",
"op": [
"vote",
{
"voter": "gavin-guile",
"author": "spayk",
"permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"weight": 10000
}
]
}2018/02/05 14:42:03
2018/02/05 14:42:03
| voter | freemp3 |
| author | spayk |
| permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19606187/Trx edc57a69fa44c5eb0bff6be050d5c978b4765bc0 |
View Raw JSON Data
{
"trx_id": "edc57a69fa44c5eb0bff6be050d5c978b4765bc0",
"block": 19606187,
"trx_in_block": 25,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T14:42:03",
"op": [
"vote",
{
"voter": "freemp3",
"author": "spayk",
"permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"weight": 10000
}
]
}2018/02/05 14:17:03
2018/02/05 14:17:03
| voter | spayk |
| author | spayk |
| permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19605687/Trx 2fd1962ad607d7396ff9997537a37a2b20f1824e |
View Raw JSON Data
{
"trx_id": "2fd1962ad607d7396ff9997537a37a2b20f1824e",
"block": 19605687,
"trx_in_block": 62,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T14:17:03",
"op": [
"vote",
{
"voter": "spayk",
"author": "spayk",
"permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"weight": 10000
}
]
}2018/02/05 14:15:21
2018/02/05 14:15:21
| author | spayk |
| permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| max accepted payout | 1000000.000 SBD |
| percent steem dollars | 0 |
| allow votes | true |
| allow curation rewards | true |
| extensions | [[0,{"beneficiaries":[{"account":"strimi","weight":1500}]}]] |
| Transaction Info | Block #19605654/Trx 2c105d2ced1a5a55d2d7543e0c2edce7facba890 |
View Raw JSON Data
{
"trx_id": "2c105d2ced1a5a55d2d7543e0c2edce7facba890",
"block": 19605654,
"trx_in_block": 62,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T14:15:21",
"op": [
"comment_options",
{
"author": "spayk",
"permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"max_accepted_payout": "1000000.000 SBD",
"percent_steem_dollars": 0,
"allow_votes": true,
"allow_curation_rewards": true,
"extensions": [
[
0,
{
"beneficiaries": [
{
"account": "strimi",
"weight": 1500
}
]
}
]
]
}
]
}spaykpublished a new post: strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z2018/02/05 14:15:21
spaykpublished a new post: strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z
2018/02/05 14:15:21
| parent author | |
| parent permlink | strimi |
| author | spayk |
| permlink | strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z |
| title | Pierwszy start rakiety Falcon Heavy – 6 lutego 2018 |
| body | <p>SpaceX przygotowuje się do pierwszego lotu Falcona Heavy. Jego start zaplanowano na 6 lutego, na godzinę 19:30 czasu polskiego (18:30 UTC). Okno startowe ma potrwać 150 minut. Po starcie planowane jest lądowanie wszystkich trzech boosterów rakiety – dwóch bocznych na lądzie i środkowego na OCISLY.</p><p><center><a href="https://strimi.it/strimi/@spayk/strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z"><img src="https://spacex.com.pl/files/2018-02/falconheavy.jpg?90ef64bf58"></a></center></p><hr><p><center><em>Posted on <a href="https://strimi.it"><strong>Strimi.it</strong></a></em></p><p><em>See the full content <a href="https://strimi.it/strimi/@spayk/strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z">Pierwszy start rakiety Falcon Heavy – 6 lutego 2018</a></em></center></p><hr> |
| json metadata | {"tags":["strimi","strimi-pl","strimi-spacex","strimi-ciekawostka"],"format":"html","app":"strimi/2.0","strimi_metadata":"{\"thumb\":\"https://spacex.com.pl/files/2018-02/falconheavy.jpg?90ef64bf58\",\"source\":\"https://spacex.com.pl/wiadomosci/pierwszy-start-rakiety-falcon-heavy\",\"domain\":\"spacex.com.pl\",\"type\":{\"type\":\"link\"},\"body\":\"SpaceX przygotowuje się do pierwszego lotu Falcona Heavy. Jego start zaplanowano na 6 lutego, na godzinę 19:30 czasu polskiego (18:30 UTC). Okno startowe ma potrwać 150 minut. Po starcie planowane jest lądowanie wszystkich trzech boosterów rakiety – dwóch bocznych na lądzie i środkowego na OCISLY.\",\"title\":\"Pierwszy start rakiety Falcon Heavy – 6 lutego 2018\"}"} |
| Transaction Info | Block #19605654/Trx 2c105d2ced1a5a55d2d7543e0c2edce7facba890 |
View Raw JSON Data
{
"trx_id": "2c105d2ced1a5a55d2d7543e0c2edce7facba890",
"block": 19605654,
"trx_in_block": 62,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T14:15:21",
"op": [
"comment",
{
"parent_author": "",
"parent_permlink": "strimi",
"author": "spayk",
"permlink": "strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z",
"title": "Pierwszy start rakiety Falcon Heavy – 6 lutego 2018",
"body": "<p>SpaceX przygotowuje się do pierwszego lotu Falcona Heavy. Jego start zaplanowano na 6 lutego, na godzinę 19:30 czasu polskiego (18:30 UTC). Okno startowe ma potrwać 150 minut. Po starcie planowane jest lądowanie wszystkich trzech boosterów rakiety – dwóch bocznych na lądzie i środkowego na OCISLY.</p><p><center><a href=\"https://strimi.it/strimi/@spayk/strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z\"><img src=\"https://spacex.com.pl/files/2018-02/falconheavy.jpg?90ef64bf58\"></a></center></p><hr><p><center><em>Posted on <a href=\"https://strimi.it\"><strong>Strimi.it</strong></a></em></p><p><em>See the full content <a href=\"https://strimi.it/strimi/@spayk/strimi-pierwszy-start-rakiety-falcon-heavy-6-lutego-2018-20180205t141524483z\">Pierwszy start rakiety Falcon Heavy – 6 lutego 2018</a></em></center></p><hr>",
"json_metadata": "{\"tags\":[\"strimi\",\"strimi-pl\",\"strimi-spacex\",\"strimi-ciekawostka\"],\"format\":\"html\",\"app\":\"strimi/2.0\",\"strimi_metadata\":\"{\\\"thumb\\\":\\\"https://spacex.com.pl/files/2018-02/falconheavy.jpg?90ef64bf58\\\",\\\"source\\\":\\\"https://spacex.com.pl/wiadomosci/pierwszy-start-rakiety-falcon-heavy\\\",\\\"domain\\\":\\\"spacex.com.pl\\\",\\\"type\\\":{\\\"type\\\":\\\"link\\\"},\\\"body\\\":\\\"SpaceX przygotowuje się do pierwszego lotu Falcona Heavy. Jego start zaplanowano na 6 lutego, na godzinę 19:30 czasu polskiego (18:30 UTC). Okno startowe ma potrwać 150 minut. Po starcie planowane jest lądowanie wszystkich trzech boosterów rakiety – dwóch bocznych na lądzie i środkowego na OCISLY.\\\",\\\"title\\\":\\\"Pierwszy start rakiety Falcon Heavy – 6 lutego 2018\\\"}\"}"
}
]
}spaykclaimed reward balance: 0.060 SBD, 0.029 SP2018/02/05 09:49:18
spaykclaimed reward balance: 0.060 SBD, 0.029 SP
2018/02/05 09:49:18
| account | spayk |
| reward steem | 0.000 STEEM |
| reward sbd | 0.060 SBD |
| reward vests | 47.049293 VESTS |
| Transaction Info | Block #19600334/Trx 069207fb6e5ec49dd2f301bad42a92d9be21c290 |
View Raw JSON Data
{
"trx_id": "069207fb6e5ec49dd2f301bad42a92d9be21c290",
"block": 19600334,
"trx_in_block": 42,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-05T09:49:18",
"op": [
"claim_reward_balance",
{
"account": "spayk",
"reward_steem": "0.000 STEEM",
"reward_sbd": "0.060 SBD",
"reward_vests": "47.049293 VESTS"
}
]
}spaykreceived 0.012 SBD, 0.004 SP author reward for @spayk / strimi-inteligentna-kamerka-google-clips-trafia-do-przedsprzeday-20180129t094844637z2018/02/05 09:48:45
spaykreceived 0.012 SBD, 0.004 SP author reward for @spayk / strimi-inteligentna-kamerka-google-clips-trafia-do-przedsprzeday-20180129t094844637z
2018/02/05 09:48:45
| author | spayk |
| permlink | strimi-inteligentna-kamerka-google-clips-trafia-do-przedsprzeday-20180129t094844637z |
| sbd payout | 0.012 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 6.136725 VESTS |
| Transaction Info | Block #19600322/Virtual Operation #3 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19600322,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 3,
"timestamp": "2018-02-05T09:48:45",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "strimi-inteligentna-kamerka-google-clips-trafia-do-przedsprzeday-20180129t094844637z",
"sbd_payout": "0.012 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "6.136725 VESTS"
}
]
}2018/02/05 09:48:45
2018/02/05 09:48:45
| benefactor | strimi |
| author | spayk |
| permlink | strimi-inteligentna-kamerka-google-clips-trafia-do-przedsprzeday-20180129t094844637z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 0.000000 VESTS |
| Transaction Info | Block #19600322/Virtual Operation #2 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19600322,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 2,
"timestamp": "2018-02-05T09:48:45",
"op": [
"comment_benefactor_reward",
{
"benefactor": "strimi",
"author": "spayk",
"permlink": "strimi-inteligentna-kamerka-google-clips-trafia-do-przedsprzeday-20180129t094844637z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "0.000000 VESTS"
}
]
}2018/02/04 22:52:33
2018/02/04 22:52:33
| author | spayk |
| permlink | f1 |
| sbd payout | 0.013 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 6.136864 VESTS |
| Transaction Info | Block #19587204/Virtual Operation #2 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19587204,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 2,
"timestamp": "2018-02-04T22:52:33",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "f1",
"sbd_payout": "0.013 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "6.136864 VESTS"
}
]
}spaykreceived 0.035 SBD, 0.011 SP author reward for @spayk / messi-barcelona-alaves-2-12018/02/04 21:31:39
spaykreceived 0.035 SBD, 0.011 SP author reward for @spayk / messi-barcelona-alaves-2-1
2018/02/04 21:31:39
| author | spayk |
| permlink | messi-barcelona-alaves-2-1 |
| sbd payout | 0.035 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 18.410646 VESTS |
| Transaction Info | Block #19585587/Virtual Operation #4 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19585587,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 4,
"timestamp": "2018-02-04T21:31:39",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "messi-barcelona-alaves-2-1",
"sbd_payout": "0.035 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "18.410646 VESTS"
}
]
}spaykreceived 0.009 SP author reward for @spayk / strimi-blockchain-jedn-z-szeciu-najintensywniej-rozwijanych-technologii-na-wiecie-20180128t203624772z2018/02/04 20:36:24
spaykreceived 0.009 SP author reward for @spayk / strimi-blockchain-jedn-z-szeciu-najintensywniej-rozwijanych-technologii-na-wiecie-20180128t203624772z
2018/02/04 20:36:24
| author | spayk |
| permlink | strimi-blockchain-jedn-z-szeciu-najintensywniej-rozwijanych-technologii-na-wiecie-20180128t203624772z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 14.319419 VESTS |
| Transaction Info | Block #19584483/Virtual Operation #19 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19584483,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 19,
"timestamp": "2018-02-04T20:36:24",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "strimi-blockchain-jedn-z-szeciu-najintensywniej-rozwijanych-technologii-na-wiecie-20180128t203624772z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "14.319419 VESTS"
}
]
}2018/02/04 20:36:24
2018/02/04 20:36:24
| benefactor | strimi |
| author | spayk |
| permlink | strimi-blockchain-jedn-z-szeciu-najintensywniej-rozwijanych-technologii-na-wiecie-20180128t203624772z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 2.045631 VESTS |
| Transaction Info | Block #19584483/Virtual Operation #18 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19584483,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 18,
"timestamp": "2018-02-04T20:36:24",
"op": [
"comment_benefactor_reward",
{
"benefactor": "strimi",
"author": "spayk",
"permlink": "strimi-blockchain-jedn-z-szeciu-najintensywniej-rozwijanych-technologii-na-wiecie-20180128t203624772z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "2.045631 VESTS"
}
]
}spaykreceived 0.001 SP curation reward for @petecko / zarabiaj-steem-przez-glosowanie-o-wynagrodzeniach-kuratorow-na-steemicie2018/02/04 18:37:48
spaykreceived 0.001 SP curation reward for @petecko / zarabiaj-steem-przez-glosowanie-o-wynagrodzeniach-kuratorow-na-steemicie
2018/02/04 18:37:48
| curator | spayk |
| reward | 2.045639 VESTS |
| comment author | petecko |
| comment permlink | zarabiaj-steem-przez-glosowanie-o-wynagrodzeniach-kuratorow-na-steemicie |
| Transaction Info | Block #19582111/Virtual Operation #44 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19582111,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 44,
"timestamp": "2018-02-04T18:37:48",
"op": [
"curation_reward",
{
"curator": "spayk",
"reward": "2.045639 VESTS",
"comment_author": "petecko",
"comment_permlink": "zarabiaj-steem-przez-glosowanie-o-wynagrodzeniach-kuratorow-na-steemicie"
}
]
}spaykclaimed reward balance: 0.014 SBD, 0.004 SP2018/02/03 14:26:12
spaykclaimed reward balance: 0.014 SBD, 0.004 SP
2018/02/03 14:26:12
| account | spayk |
| reward steem | 0.000 STEEM |
| reward sbd | 0.014 SBD |
| reward vests | 6.137334 VESTS |
| Transaction Info | Block #19548396/Trx fe600444ec9e77afc91ae9fee0f1c459b6659b40 |
View Raw JSON Data
{
"trx_id": "fe600444ec9e77afc91ae9fee0f1c459b6659b40",
"block": 19548396,
"trx_in_block": 7,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-03T14:26:12",
"op": [
"claim_reward_balance",
{
"account": "spayk",
"reward_steem": "0.000 STEEM",
"reward_sbd": "0.014 SBD",
"reward_vests": "6.137334 VESTS"
}
]
}spaykreceived 0.014 SBD, 0.004 SP author reward for @spayk / strimi-rakieta-falcon-heavy-by-moe-wystartuje-ju-6-lutego-20180127t100209205z2018/02/03 10:02:09
spaykreceived 0.014 SBD, 0.004 SP author reward for @spayk / strimi-rakieta-falcon-heavy-by-moe-wystartuje-ju-6-lutego-20180127t100209205z
2018/02/03 10:02:09
| author | spayk |
| permlink | strimi-rakieta-falcon-heavy-by-moe-wystartuje-ju-6-lutego-20180127t100209205z |
| sbd payout | 0.014 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 6.137334 VESTS |
| Transaction Info | Block #19543118/Virtual Operation #10 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19543118,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 10,
"timestamp": "2018-02-03T10:02:09",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "strimi-rakieta-falcon-heavy-by-moe-wystartuje-ju-6-lutego-20180127t100209205z",
"sbd_payout": "0.014 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "6.137334 VESTS"
}
]
}2018/02/03 10:02:09
2018/02/03 10:02:09
| benefactor | strimi |
| author | spayk |
| permlink | strimi-rakieta-falcon-heavy-by-moe-wystartuje-ju-6-lutego-20180127t100209205z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 0.000000 VESTS |
| Transaction Info | Block #19543118/Virtual Operation #9 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19543118,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 9,
"timestamp": "2018-02-03T10:02:09",
"op": [
"comment_benefactor_reward",
{
"benefactor": "strimi",
"author": "spayk",
"permlink": "strimi-rakieta-falcon-heavy-by-moe-wystartuje-ju-6-lutego-20180127t100209205z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "0.000000 VESTS"
}
]
}2018/02/03 09:20:00
2018/02/03 09:20:00
| voter | spayk |
| author | acronyms |
| permlink | strimi-rozbudowa-portu-canaveral-dla-celw-przemysu-kosmicznego-20180203t011755037z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19542277/Trx 45f613922f3769a434cc2583382a7c0d85e77f72 |
View Raw JSON Data
{
"trx_id": "45f613922f3769a434cc2583382a7c0d85e77f72",
"block": 19542277,
"trx_in_block": 29,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-03T09:20:00",
"op": [
"vote",
{
"voter": "spayk",
"author": "acronyms",
"permlink": "strimi-rozbudowa-portu-canaveral-dla-celw-przemysu-kosmicznego-20180203t011755037z",
"weight": 10000
}
]
}2018/02/02 23:46:00
2018/02/02 23:46:00
| voter | spayk |
| author | holospl |
| permlink | strimi-samsung-produkuje-ukady-wyspecjalizowne-w-kopaniu-bitcoinw-20180202t225012665z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19530804/Trx f51a5364ce7bda8d74781039e1379cb5eaf88c3c |
View Raw JSON Data
{
"trx_id": "f51a5364ce7bda8d74781039e1379cb5eaf88c3c",
"block": 19530804,
"trx_in_block": 49,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-02T23:46:00",
"op": [
"vote",
{
"voter": "spayk",
"author": "holospl",
"permlink": "strimi-samsung-produkuje-ukady-wyspecjalizowne-w-kopaniu-bitcoinw-20180202t225012665z",
"weight": 10000
}
]
}ruudmanagerreplied to @spayk / re-spayk-f1-20180202t193538756z2018/02/02 19:35:42
ruudmanagerreplied to @spayk / re-spayk-f1-20180202t193538756z
2018/02/02 19:35:42
| parent author | spayk |
| parent permlink | f1 |
| author | ruudmanager |
| permlink | re-spayk-f1-20180202t193538756z |
| title | |
| body | Awesome pic! Really captures the speed. |
| json metadata | {"tags":["photography"],"app":"steemit/0.1"} |
| Transaction Info | Block #19525807/Trx 5c09fcb9a783ecacebcbead37bf0b28f658fcd1e |
View Raw JSON Data
{
"trx_id": "5c09fcb9a783ecacebcbead37bf0b28f658fcd1e",
"block": 19525807,
"trx_in_block": 36,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-02T19:35:42",
"op": [
"comment",
{
"parent_author": "spayk",
"parent_permlink": "f1",
"author": "ruudmanager",
"permlink": "re-spayk-f1-20180202t193538756z",
"title": "",
"body": "Awesome pic! Really captures the speed.",
"json_metadata": "{\"tags\":[\"photography\"],\"app\":\"steemit/0.1\"}"
}
]
}ruudmanagerupvoted (100.00%) @spayk / f12018/02/02 19:34:27
ruudmanagerupvoted (100.00%) @spayk / f1
2018/02/02 19:34:27
| voter | ruudmanager |
| author | spayk |
| permlink | f1 |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19525782/Trx a7c356f738c93c5c9852278f278fbc86ae8ee392 |
View Raw JSON Data
{
"trx_id": "a7c356f738c93c5c9852278f278fbc86ae8ee392",
"block": 19525782,
"trx_in_block": 2,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-02T19:34:27",
"op": [
"vote",
{
"voter": "ruudmanager",
"author": "spayk",
"permlink": "f1",
"weight": 10000
}
]
}spaykclaimed reward balance: 0.015 SP2018/02/02 18:21:03
spaykclaimed reward balance: 0.015 SP
2018/02/02 18:21:03
| account | spayk |
| reward steem | 0.000 STEEM |
| reward sbd | 0.000 SBD |
| reward vests | 24.550514 VESTS |
| Transaction Info | Block #19524318/Trx b8152e976b1950790d647f92eff86bca59a55a20 |
View Raw JSON Data
{
"trx_id": "b8152e976b1950790d647f92eff86bca59a55a20",
"block": 19524318,
"trx_in_block": 67,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-02T18:21:03",
"op": [
"claim_reward_balance",
{
"account": "spayk",
"reward_steem": "0.000 STEEM",
"reward_sbd": "0.000 SBD",
"reward_vests": "24.550514 VESTS"
}
]
}spaykreceived 0.015 SP author reward for @spayk / strimi-jest-aplikacja-oparta-o-si-do-tworzenia-faszywego-porno-internet-szaleje-20180126t110205349z2018/02/02 11:02:06
spaykreceived 0.015 SP author reward for @spayk / strimi-jest-aplikacja-oparta-o-si-do-tworzenia-faszywego-porno-internet-szaleje-20180126t110205349z
2018/02/02 11:02:06
| author | spayk |
| permlink | strimi-jest-aplikacja-oparta-o-si-do-tworzenia-faszywego-porno-internet-szaleje-20180126t110205349z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 24.550514 VESTS |
| Transaction Info | Block #19515554/Virtual Operation #8 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19515554,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 8,
"timestamp": "2018-02-02T11:02:06",
"op": [
"author_reward",
{
"author": "spayk",
"permlink": "strimi-jest-aplikacja-oparta-o-si-do-tworzenia-faszywego-porno-internet-szaleje-20180126t110205349z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "24.550514 VESTS"
}
]
}2018/02/02 11:02:06
2018/02/02 11:02:06
| benefactor | strimi |
| author | spayk |
| permlink | strimi-jest-aplikacja-oparta-o-si-do-tworzenia-faszywego-porno-internet-szaleje-20180126t110205349z |
| sbd payout | 0.000 SBD |
| steem payout | 0.000 STEEM |
| vesting payout | 2.045876 VESTS |
| Transaction Info | Block #19515554/Virtual Operation #7 |
View Raw JSON Data
{
"trx_id": "0000000000000000000000000000000000000000",
"block": 19515554,
"trx_in_block": 4294967295,
"op_in_trx": 0,
"virtual_op": 7,
"timestamp": "2018-02-02T11:02:06",
"op": [
"comment_benefactor_reward",
{
"benefactor": "strimi",
"author": "spayk",
"permlink": "strimi-jest-aplikacja-oparta-o-si-do-tworzenia-faszywego-porno-internet-szaleje-20180126t110205349z",
"sbd_payout": "0.000 SBD",
"steem_payout": "0.000 STEEM",
"vesting_payout": "2.045876 VESTS"
}
]
}spaykupvoted (100.00%) @kargul09 / strimi-nowy-dron-transportowy-od-boeinga-20180201t194415582z2018/02/01 22:40:33
spaykupvoted (100.00%) @kargul09 / strimi-nowy-dron-transportowy-od-boeinga-20180201t194415582z
2018/02/01 22:40:33
| voter | spayk |
| author | kargul09 |
| permlink | strimi-nowy-dron-transportowy-od-boeinga-20180201t194415582z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19500742/Trx 9eae2852d4165ec7ccf8a0e1ba2bbb7080bc6d64 |
View Raw JSON Data
{
"trx_id": "9eae2852d4165ec7ccf8a0e1ba2bbb7080bc6d64",
"block": 19500742,
"trx_in_block": 41,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-01T22:40:33",
"op": [
"vote",
{
"voter": "spayk",
"author": "kargul09",
"permlink": "strimi-nowy-dron-transportowy-od-boeinga-20180201t194415582z",
"weight": 10000
}
]
}2018/02/01 22:39:03
2018/02/01 22:39:03
| voter | azor3k |
| author | spayk |
| permlink | strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19500712/Trx 5bf05f0701f59c6ab29bae1c3930dc837e0d895a |
View Raw JSON Data
{
"trx_id": "5bf05f0701f59c6ab29bae1c3930dc837e0d895a",
"block": 19500712,
"trx_in_block": 6,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-01T22:39:03",
"op": [
"vote",
{
"voter": "azor3k",
"author": "spayk",
"permlink": "strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z",
"weight": 10000
}
]
}2018/02/01 18:52:27
2018/02/01 18:52:27
| voter | frywolnystrzelec |
| author | spayk |
| permlink | strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19496191/Trx 64a238a399d1931ca8f54112a1172a8d60bf1b9d |
View Raw JSON Data
{
"trx_id": "64a238a399d1931ca8f54112a1172a8d60bf1b9d",
"block": 19496191,
"trx_in_block": 31,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-01T18:52:27",
"op": [
"vote",
{
"voter": "frywolnystrzelec",
"author": "spayk",
"permlink": "strimi-australijska-bateria-tesli-w-cigu-kilku-dni-zarobia-800-tysicy-dolarw-20180130t111225834z",
"weight": 10000
}
]
}2018/02/01 09:39:48
2018/02/01 09:39:48
| voter | spayk |
| author | anty-kowal |
| permlink | strimi-firma-g2acom-bdzie-pracowa-nad-technologi-blockchain-20180201t074639825z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19485161/Trx cc461794e6fd61beb77edc879fa4ea8dfb40d882 |
View Raw JSON Data
{
"trx_id": "cc461794e6fd61beb77edc879fa4ea8dfb40d882",
"block": 19485161,
"trx_in_block": 21,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-01T09:39:48",
"op": [
"vote",
{
"voter": "spayk",
"author": "anty-kowal",
"permlink": "strimi-firma-g2acom-bdzie-pracowa-nad-technologi-blockchain-20180201t074639825z",
"weight": 10000
}
]
}chipmcdonaldupvoted (100.00%) @spayk / f12018/02/01 02:33:06
chipmcdonaldupvoted (100.00%) @spayk / f1
2018/02/01 02:33:06
| voter | chipmcdonald |
| author | spayk |
| permlink | f1 |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19476643/Trx c4ab12ddf28feda9b4eb3ed7cb93e8f8a149b2af |
View Raw JSON Data
{
"trx_id": "c4ab12ddf28feda9b4eb3ed7cb93e8f8a149b2af",
"block": 19476643,
"trx_in_block": 39,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-02-01T02:33:06",
"op": [
"vote",
{
"voter": "chipmcdonald",
"author": "spayk",
"permlink": "f1",
"weight": 10000
}
]
}2018/01/31 21:16:54
2018/01/31 21:16:54
| voter | spayk |
| author | zenfil |
| permlink | strimi-maski-antysmogowe-pod-lup-uokik-cz-przepuszcza-szkodliwe-pyy-20180131t201646468z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19470331/Trx b5bd52b7005350f22cd0e3887d4e85d83c4fb773 |
View Raw JSON Data
{
"trx_id": "b5bd52b7005350f22cd0e3887d4e85d83c4fb773",
"block": 19470331,
"trx_in_block": 17,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T21:16:54",
"op": [
"vote",
{
"voter": "spayk",
"author": "zenfil",
"permlink": "strimi-maski-antysmogowe-pod-lup-uokik-cz-przepuszcza-szkodliwe-pyy-20180131t201646468z",
"weight": 10000
}
]
}frywolnystrzelecupvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 19:13:09
frywolnystrzelecupvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 19:13:09
| voter | frywolnystrzelec |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19467856/Trx b249eb1cb1b6773ee791c4ed70c5e4bd82b819cc |
View Raw JSON Data
{
"trx_id": "b249eb1cb1b6773ee791c4ed70c5e4bd82b819cc",
"block": 19467856,
"trx_in_block": 68,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T19:13:09",
"op": [
"vote",
{
"voter": "frywolnystrzelec",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 10000
}
]
}2018/01/31 18:51:39
2018/01/31 18:51:39
| voter | nicniezgrublem |
| author | spayk |
| permlink | re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z |
| weight | 2500 (25.00%) |
| Transaction Info | Block #19467427/Trx bb874afd0f89cfdc0b2e5235fdb69a17086af569 |
View Raw JSON Data
{
"trx_id": "bb874afd0f89cfdc0b2e5235fdb69a17086af569",
"block": 19467427,
"trx_in_block": 20,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T18:51:39",
"op": [
"vote",
{
"voter": "nicniezgrublem",
"author": "spayk",
"permlink": "re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z",
"weight": 2500
}
]
}2018/01/31 18:21:36
2018/01/31 18:21:36
| parent author | nicniezgrublem |
| parent permlink | strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z |
| author | spayk |
| permlink | re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z |
| title | |
| body | @nicniezgrublem https://i.imgur.com/mk5uNWd.png |
| json metadata | {"tags":["strimi-stream"],"users":["nicniezgrublem"],"app":"steemit/0.1","image":["https://i.imgur.com/mk5uNWd.png"]} |
| Transaction Info | Block #19466826/Trx 6a5531e2c1b231fd4e190d4ee266f746a31de51d |
View Raw JSON Data
{
"trx_id": "6a5531e2c1b231fd4e190d4ee266f746a31de51d",
"block": 19466826,
"trx_in_block": 46,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T18:21:36",
"op": [
"comment",
{
"parent_author": "nicniezgrublem",
"parent_permlink": "strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z",
"author": "spayk",
"permlink": "re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z",
"title": "",
"body": "@nicniezgrublem \nhttps://i.imgur.com/mk5uNWd.png",
"json_metadata": "{\"tags\":[\"strimi-stream\"],\"users\":[\"nicniezgrublem\"],\"app\":\"steemit/0.1\",\"image\":[\"https://i.imgur.com/mk5uNWd.png\"]}"
}
]
}2018/01/31 18:21:15
2018/01/31 18:21:15
| parent author | nicniezgrublem |
| parent permlink | strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z |
| author | spayk |
| permlink | re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z |
| title | |
| body | @nicniezgrublem http://pl.memgenerator.pl/mem-image/paolcia-obiecuje-ze-bede-grzeczny-pl-ffffff/d |
| json metadata | {"tags":["strimi-stream"],"users":["nicniezgrublem"],"links":["http://pl.memgenerator.pl/mem-image/paolcia-obiecuje-ze-bede-grzeczny-pl-ffffff/d"],"app":"steemit/0.1"} |
| Transaction Info | Block #19466819/Trx d8e833228be07742df643e131e136c2a2106d68f |
View Raw JSON Data
{
"trx_id": "d8e833228be07742df643e131e136c2a2106d68f",
"block": 19466819,
"trx_in_block": 45,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T18:21:15",
"op": [
"comment",
{
"parent_author": "nicniezgrublem",
"parent_permlink": "strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z",
"author": "spayk",
"permlink": "re-nicniezgrublem-strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t182151418z",
"title": "",
"body": "@nicniezgrublem \nhttp://pl.memgenerator.pl/mem-image/paolcia-obiecuje-ze-bede-grzeczny-pl-ffffff/d",
"json_metadata": "{\"tags\":[\"strimi-stream\"],\"users\":[\"nicniezgrublem\"],\"links\":[\"http://pl.memgenerator.pl/mem-image/paolcia-obiecuje-ze-bede-grzeczny-pl-ffffff/d\"],\"app\":\"steemit/0.1\"}"
}
]
}azor3kupvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 17:43:33
azor3kupvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 17:43:33
| voter | azor3k |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19466066/Trx eb896f7e61888cdfab16cf1bb92acf0cebc57564 |
View Raw JSON Data
{
"trx_id": "eb896f7e61888cdfab16cf1bb92acf0cebc57564",
"block": 19466066,
"trx_in_block": 26,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T17:43:33",
"op": [
"vote",
{
"voter": "azor3k",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 10000
}
]
}kamilowskiflagged (-100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 17:38:51
kamilowskiflagged (-100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 17:38:51
| voter | kamilowski |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | -10000 (-100.00%) |
| Transaction Info | Block #19465972/Trx 6fd7a1772e22e4a8b283b50cbe76ce63e5e1fcd5 |
View Raw JSON Data
{
"trx_id": "6fd7a1772e22e4a8b283b50cbe76ce63e5e1fcd5",
"block": 19465972,
"trx_in_block": 15,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T17:38:51",
"op": [
"vote",
{
"voter": "kamilowski",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": -10000
}
]
}2018/01/31 15:41:51
2018/01/31 15:41:51
| parent author | spayk |
| parent permlink | strimi-plusowahttpsstrimiplstrimispaykstrimi-polskie-drogi-109-20180131t131409375zstrimi-reklama-rozkrecamystrimi-20180131t132321472z |
| author | nicniezgrublem |
| permlink | strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z |
| title | |
| body | @@ -1,8 +1,4 @@ -%5B!%5D( http @@ -63,5 +63,4 @@ .jpg -) |
| json metadata | {"tags":["strimi-stream"],"format":"html","app":"steemit/0.1","image":["http://komedyja.pl/upload/6823c191fe4d1f0ad85dbf15065fc1399803.jpg"]} |
| Transaction Info | Block #19463632/Trx 209ffe9701e1e61b645624c1cd27b0b24b2ef9bb |
View Raw JSON Data
{
"trx_id": "209ffe9701e1e61b645624c1cd27b0b24b2ef9bb",
"block": 19463632,
"trx_in_block": 5,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T15:41:51",
"op": [
"comment",
{
"parent_author": "spayk",
"parent_permlink": "strimi-plusowahttpsstrimiplstrimispaykstrimi-polskie-drogi-109-20180131t131409375zstrimi-reklama-rozkrecamystrimi-20180131t132321472z",
"author": "nicniezgrublem",
"permlink": "strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z",
"title": "",
"body": "@@ -1,8 +1,4 @@\n-%5B!%5D(\n http\n@@ -63,5 +63,4 @@\n .jpg\n-)\n",
"json_metadata": "{\"tags\":[\"strimi-stream\"],\"format\":\"html\",\"app\":\"steemit/0.1\",\"image\":[\"http://komedyja.pl/upload/6823c191fe4d1f0ad85dbf15065fc1399803.jpg\"]}"
}
]
}2018/01/31 15:41:03
2018/01/31 15:41:03
| parent author | spayk |
| parent permlink | strimi-plusowahttpsstrimiplstrimispaykstrimi-polskie-drogi-109-20180131t131409375zstrimi-reklama-rozkrecamystrimi-20180131t132321472z |
| author | nicniezgrublem |
| permlink | strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z |
| title | |
| body | [!](http://komedyja.pl/upload/6823c191fe4d1f0ad85dbf15065fc1399803.jpg) |
| json metadata | {"tags":"","format":"html","app":"strimi/2.0"} |
| Transaction Info | Block #19463616/Trx 6042ce6ef14e209405e15d0924da7a6cd6f47f88 |
View Raw JSON Data
{
"trx_id": "6042ce6ef14e209405e15d0924da7a6cd6f47f88",
"block": 19463616,
"trx_in_block": 27,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T15:41:03",
"op": [
"comment",
{
"parent_author": "spayk",
"parent_permlink": "strimi-plusowahttpsstrimiplstrimispaykstrimi-polskie-drogi-109-20180131t131409375zstrimi-reklama-rozkrecamystrimi-20180131t132321472z",
"author": "nicniezgrublem",
"permlink": "strimi-httpkomedyjaplupload6823c191fe4d1f0ad85dbf15065fc1399803jpg-20180131t154104389z",
"title": "",
"body": "[!](http://komedyja.pl/upload/6823c191fe4d1f0ad85dbf15065fc1399803.jpg)",
"json_metadata": "{\"tags\":\"\",\"format\":\"html\",\"app\":\"strimi/2.0\"}"
}
]
}lubiearbuzyupvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 14:39:54
lubiearbuzyupvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 14:39:54
| voter | lubiearbuzy |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19462393/Trx 730f586fda40d303b7524de043f494ace4a9aba0 |
View Raw JSON Data
{
"trx_id": "730f586fda40d303b7524de043f494ace4a9aba0",
"block": 19462393,
"trx_in_block": 10,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T14:39:54",
"op": [
"vote",
{
"voter": "lubiearbuzy",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 10000
}
]
}lolek32upvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 13:49:30
lolek32upvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 13:49:30
| voter | lolek32 |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19461385/Trx e432e18774dde414b7156cc6d49d6bfe4fdf5a64 |
View Raw JSON Data
{
"trx_id": "e432e18774dde414b7156cc6d49d6bfe4fdf5a64",
"block": 19461385,
"trx_in_block": 32,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T13:49:30",
"op": [
"vote",
{
"voter": "lolek32",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 10000
}
]
}gavin-guileremoved vote from (0.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 13:30:36
gavin-guileremoved vote from (0.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 13:30:36
| voter | gavin-guile |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 0 (0.00%) |
| Transaction Info | Block #19461007/Trx b23c70068800619223a1d68aeaa67963dd68ce52 |
View Raw JSON Data
{
"trx_id": "b23c70068800619223a1d68aeaa67963dd68ce52",
"block": 19461007,
"trx_in_block": 17,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T13:30:36",
"op": [
"vote",
{
"voter": "gavin-guile",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 0
}
]
}gavin-guileupvoted (85.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 13:28:39
gavin-guileupvoted (85.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 13:28:39
| voter | gavin-guile |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 8500 (85.00%) |
| Transaction Info | Block #19460968/Trx 11097d159b68e7657a4947bf9be5557a705e3d9e |
View Raw JSON Data
{
"trx_id": "11097d159b68e7657a4947bf9be5557a705e3d9e",
"block": 19460968,
"trx_in_block": 15,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T13:28:39",
"op": [
"vote",
{
"voter": "gavin-guile",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 8500
}
]
}kargul09upvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z2018/01/31 13:23:06
kargul09upvoted (100.00%) @spayk / strimi-polskie-drogi-109-20180131t131409375z
2018/01/31 13:23:06
| voter | kargul09 |
| author | spayk |
| permlink | strimi-polskie-drogi-109-20180131t131409375z |
| weight | 10000 (100.00%) |
| Transaction Info | Block #19460857/Trx a9587ca27b96e2bf3de02b9e1bdf73cb22bc26f5 |
View Raw JSON Data
{
"trx_id": "a9587ca27b96e2bf3de02b9e1bdf73cb22bc26f5",
"block": 19460857,
"trx_in_block": 41,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T13:23:06",
"op": [
"vote",
{
"voter": "kargul09",
"author": "spayk",
"permlink": "strimi-polskie-drogi-109-20180131t131409375z",
"weight": 10000
}
]
}2018/01/31 13:22:45
2018/01/31 13:22:45
| author | spayk |
| permlink | strimi-plusowahttpsstrimiplstrimispaykstrimi-polskie-drogi-109-20180131t131409375zstrimi-reklama-rozkrecamystrimi-20180131t132321472z |
| max accepted payout | 1000000.000 SBD |
| percent steem dollars | 0 |
| allow votes | true |
| allow curation rewards | true |
| extensions | [[0,{"beneficiaries":[{"account":"strimi","weight":1500}]}]] |
| Transaction Info | Block #19460850/Trx 09d83ad56d729c7c559757e8c4ddab555f90ecc1 |
View Raw JSON Data
{
"trx_id": "09d83ad56d729c7c559757e8c4ddab555f90ecc1",
"block": 19460850,
"trx_in_block": 50,
"op_in_trx": 0,
"virtual_op": 0,
"timestamp": "2018-01-31T13:22:45",
"op": [
"comment_options",
{
"author": "spayk",
"permlink": "strimi-plusowahttpsstrimiplstrimispaykstrimi-polskie-drogi-109-20180131t131409375zstrimi-reklama-rozkrecamystrimi-20180131t132321472z",
"max_accepted_payout": "1000000.000 SBD",
"percent_steem_dollars": 0,
"allow_votes": true,
"allow_curation_rewards": true,
"extensions": [
[
0,
{
"beneficiaries": [
{
"account": "strimi",
"weight": 1500
}
]
}
]
]
}
]
}Manabar
Voting Power100.00%
Downvote Power100.00%
Resource Credits100.00%
Reputation Progress39.39%
{
"voting_manabar": {
"current_mana": "8143659806",
"last_update_time": 1779086826
},
"downvote_manabar": {
"current_mana": 2035914951,
"last_update_time": 1779086826
},
"rc_account": {
"account": "spayk",
"rc_manabar": {
"current_mana": "10164408779",
"last_update_time": 1779086826
},
"max_rc_creation_adjustment": {
"amount": "2020748973",
"precision": 6,
"nai": "@@000000037"
},
"max_rc": "10164408779"
}
}Account Metadata
| POSTING JSON METADATA | |
| profile | {"location":"Krakow","profile_image":"https://i.imgur.com/CbZy8qw.png"} |
| JSON METADATA | |
| profile | {"location":"Krakow","profile_image":"https://i.imgur.com/CbZy8qw.png"} |
{
"posting_json_metadata": {
"profile": {
"location": "Krakow",
"profile_image": "https://i.imgur.com/CbZy8qw.png"
}
},
"json_metadata": {
"profile": {
"location": "Krakow",
"profile_image": "https://i.imgur.com/CbZy8qw.png"
}
}
}Auth Keys
Owner
Single Signature
Public Keys
STM7rwM3ikC5cCYgUTmSMKsy4ShSw9BTmFTPgHrsatTHE4FF8pfue1/1
Active
Single Signature
Public Keys
STM6eTivYLQTJi8DRBksTSRk3DGoQWHxdcqVDYZLTs3qF7Px16ajm1/1
Posting
Single Signature
Public Keys
STM7156iPcLdi2dNgvSYRy8gJ4tuMsEJDJpEVFQxwkjaw2QPMvxDe1/1
Memo
STM7d78LqSCMLHGw4N8pbHSKaZARbzayYqdspmLXG4pWicxeZo4dS
{
"owner": {
"weight_threshold": 1,
"account_auths": [],
"key_auths": [
[
"STM7rwM3ikC5cCYgUTmSMKsy4ShSw9BTmFTPgHrsatTHE4FF8pfue",
1
]
]
},
"active": {
"weight_threshold": 1,
"account_auths": [],
"key_auths": [
[
"STM6eTivYLQTJi8DRBksTSRk3DGoQWHxdcqVDYZLTs3qF7Px16ajm",
1
]
]
},
"posting": {
"weight_threshold": 1,
"account_auths": [],
"key_auths": [
[
"STM7156iPcLdi2dNgvSYRy8gJ4tuMsEJDJpEVFQxwkjaw2QPMvxDe",
1
]
]
},
"memo": "STM7d78LqSCMLHGw4N8pbHSKaZARbzayYqdspmLXG4pWicxeZo4dS"
}Witness Votes
0 / 30
No active witness votes.
[]