Ecoer Logo

@lucydico

59

Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.

steemit.com/@lucydico
VOTING POWER100.00%
DOWNVOTE POWER100.00%
RESOURCE CREDITS100.00%
REPUTATION PROGRESS92.92%
Net Worth
15.349USD
STEEM
215.421STEEM
SBD
5.831SBD
Own SP
14.777SP

Detailed Balance

STEEM
balance
57.322STEEM
market_balance
0.000STEEM
savings_balance
0.000STEEM
reward_steem_balance
158.099STEEM
STEEM POWER
Own SP
14.777SP
Delegated Out
0.000SP
Delegation In
0.000SP
Effective Power
14.777SP
Reward SP (pending)
158.103SP
SBD
sbd_balance
5.831SBD
sbd_conversions
0.000SBD
sbd_market_balance
0.000SBD
savings_sbd_balance
0.000SBD
reward_sbd_balance
0.000SBD
{
  "balance": "57.322 STEEM",
  "savings_balance": "0.000 STEEM",
  "reward_steem_balance": "158.099 STEEM",
  "vesting_shares": "24063.449289 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "0.000000 VESTS",
  "sbd_balance": "5.831 SBD",
  "savings_sbd_balance": "0.000 SBD",
  "reward_sbd_balance": "0.000 SBD",
  "conversions": []
}

Account Info

namelucydico
id688089
rank98,922
reputation5887160315372
created2018-01-29T18:44:33
recovery_accountsteem
proxyNone
post_count160
comment_count0
lifetime_vote_count0
witnesses_voted_for0
last_post2018-09-13T06:15:57
last_root_post2018-09-13T06:15:57
last_vote_time2019-05-29T20:57:54
proxied_vsf_votes0, 0, 0, 0
can_vote1
voting_power9,799
delayed_votes0
balance57.322 STEEM
savings_balance0.000 STEEM
sbd_balance5.831 SBD
savings_sbd_balance0.000 SBD
vesting_shares24063.449289 VESTS
delegated_vesting_shares0.000000 VESTS
received_vesting_shares0.000000 VESTS
reward_vesting_balance320153.178118 VESTS
vesting_balance0.000 STEEM
vesting_withdraw_rate0.000000 VESTS
next_vesting_withdrawal1969-12-31T23:59:59
withdrawn97252939823
to_withdraw97252939823
withdraw_routes0
savings_withdraw_requests0
last_account_recovery1970-01-01T00:00:00
reset_accountnull
last_owner_update1970-01-01T00:00:00
last_account_update2018-07-24T20:51:42
minedNo
sbd_seconds7,694,896,626
sbd_last_interest_payment2018-08-20T07:05:30
savings_sbd_last_interest_payment1970-01-01T00:00:00
{
  "id": 688089,
  "name": "lucydico",
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM5zjvKf9ddzA71w3g7orWcjxk5y6rm2ozpkyrNWwEt5G5HgtJJF",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM86LZXgrAXvDLoSU7xrnJ7pbSAFyM144QBbT684FiHPiUq4CCcn",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [
      [
        "steemauto",
        1
      ]
    ],
    "key_auths": [
      [
        "STM5YVhvNVT1i8aQtQc7eEFcoxvygYpsTSVYGBTVJVAqrLimwUAwo",
        1
      ]
    ]
  },
  "memo_key": "STM5h8khPmvR3FR4ou6r3FqnPWZqUpzDZbJdYJaDYg2fXJ3NA7QwY",
  "json_metadata": "{\"profile\":{\"profile_image\":\"https://tokenmarket.net/blockchain-static/ethereum/assets/lucyd/logo_big.png\",\"name\":\"Lucyd\",\"about\":\"Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.\",\"website\":\"https://lucyd.co\"}}",
  "posting_json_metadata": "{\"profile\":{\"profile_image\":\"https://tokenmarket.net/blockchain-static/ethereum/assets/lucyd/logo_big.png\",\"name\":\"Lucyd\",\"about\":\"Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.\",\"website\":\"https://lucyd.co\"}}",
  "proxy": "",
  "last_owner_update": "1970-01-01T00:00:00",
  "last_account_update": "2018-07-24T20:51:42",
  "created": "2018-01-29T18:44:33",
  "mined": false,
  "recovery_account": "steem",
  "last_account_recovery": "1970-01-01T00:00:00",
  "reset_account": "null",
  "comment_count": 0,
  "lifetime_vote_count": 0,
  "post_count": 160,
  "can_vote": true,
  "voting_manabar": {
    "current_mana": "23582180303",
    "last_update_time": 1559163474
  },
  "downvote_manabar": {
    "current_mana": 0,
    "last_update_time": 1517251473
  },
  "voting_power": 9799,
  "balance": "57.322 STEEM",
  "savings_balance": "0.000 STEEM",
  "sbd_balance": "5.831 SBD",
  "sbd_seconds": "7694896626",
  "sbd_seconds_last_update": "2018-09-04T13:58:21",
  "sbd_last_interest_payment": "2018-08-20T07:05:30",
  "savings_sbd_balance": "0.000 SBD",
  "savings_sbd_seconds": "0",
  "savings_sbd_seconds_last_update": "1970-01-01T00:00:00",
  "savings_sbd_last_interest_payment": "1970-01-01T00:00:00",
  "savings_withdraw_requests": 0,
  "reward_sbd_balance": "0.000 SBD",
  "reward_steem_balance": "158.099 STEEM",
  "reward_vesting_balance": "320153.178118 VESTS",
  "reward_vesting_steem": "158.103 STEEM",
  "vesting_shares": "24063.449289 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "0.000000 VESTS",
  "vesting_withdraw_rate": "0.000000 VESTS",
  "next_vesting_withdrawal": "1969-12-31T23:59:59",
  "withdrawn": "97252939823",
  "to_withdraw": "97252939823",
  "withdraw_routes": 0,
  "curation_rewards": 1,
  "posting_rewards": 442557,
  "proxied_vsf_votes": [
    0,
    0,
    0,
    0
  ],
  "witnesses_voted_for": 0,
  "last_post": "2018-09-13T06:15:57",
  "last_root_post": "2018-09-13T06:15:57",
  "last_vote_time": "2019-05-29T20:57:54",
  "post_bandwidth": 0,
  "pending_claimed_accounts": 0,
  "vesting_balance": "0.000 STEEM",
  "reputation": "5887160315372",
  "transfer_history": [],
  "market_history": [],
  "post_history": [],
  "vote_history": [],
  "other_history": [],
  "witness_votes": [],
  "tags_usage": [],
  "guest_bloggers": [],
  "rank": 98922
}

Withdraw Routes

IncomingOutgoing
Empty
Empty
{
  "incoming": [],
  "outgoing": []
}
From Date
To Date
2020/03/02 09:04:57
voterthegoldenleaper
authorlucydico
permlinkall-sizzle-and-no-steak-magic-leap-finally-releases-their-first-headset
weight10000 (100.00%)
Transaction InfoBlock #41296353/Trx 477a19e14760796966d395d70799fc8594031db7
View Raw JSON Data
{
  "trx_id": "477a19e14760796966d395d70799fc8594031db7",
  "block": 41296353,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-03-02T09:04:57",
  "op": [
    "vote",
    {
      "voter": "thegoldenleaper",
      "author": "lucydico",
      "permlink": "all-sizzle-and-no-steak-magic-leap-finally-releases-their-first-headset",
      "weight": 10000
    }
  ]
}
2020/01/30 00:16:27
parent authorlucydico
parent permlinkpress-release-lucyd-launches-first-prescription-audio-glasses
authorsteemitboard
permlinksteemitboard-notify-lucydico-20200130t001626000z
title
bodyCongratulations @lucydico! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@lucydico/birthday2.png</td><td>Happy Birthday! - You are on the Steem blockchain for 2 years!</td></tr></table> <sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@lucydico) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=lucydico)_</sub> ###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #40366230/Trx 6550cf63b761dda015bdf07e6abe601d0731f96e
View Raw JSON Data
{
  "trx_id": "6550cf63b761dda015bdf07e6abe601d0731f96e",
  "block": 40366230,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-01-30T00:16:27",
  "op": [
    "comment",
    {
      "parent_author": "lucydico",
      "parent_permlink": "press-release-lucyd-launches-first-prescription-audio-glasses",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-lucydico-20200130t001626000z",
      "title": "",
      "body": "Congratulations @lucydico! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@lucydico/birthday2.png</td><td>Happy Birthday! - You are on the Steem blockchain for 2 years!</td></tr></table>\n\n<sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@lucydico) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=lucydico)_</sub>\n\n\n###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2019/05/29 20:57:54
voterlucydico
authoromniloquent
permlinkgoing-to-get-back-in-the-saddle-soon
weight10000 (100.00%)
Transaction InfoBlock #33342001/Trx 7b666c4e8feeb5a8983fdf932afda4905e3143b0
View Raw JSON Data
{
  "trx_id": "7b666c4e8feeb5a8983fdf932afda4905e3143b0",
  "block": 33342001,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-05-29T20:57:54",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "going-to-get-back-in-the-saddle-soon",
      "weight": 10000
    }
  ]
}
merlin7sent 0.001 STEEM to @lucydico- "***Have you heard of magic dice in steem platform,which doubles your STEEM and SBD.I have doubled 2000 STEEM (see my Steem Power as proof)check this link and register to double your STEEM/SBD. https:/..."
2019/05/02 06:08:00
frommerlin7
tolucydico
amount0.001 STEEM
memo***Have you heard of magic dice in steem platform,which doubles your STEEM and SBD.I have doubled 2000 STEEM (see my Steem Power as proof)check this link and register to double your STEEM/SBD. https://bit.ly/magicdice2
Transaction InfoBlock #32547131/Trx f1c867cfe1fac23cf09df29e7a7ce0cfc78b3a2d
View Raw JSON Data
{
  "trx_id": "f1c867cfe1fac23cf09df29e7a7ce0cfc78b3a2d",
  "block": 32547131,
  "trx_in_block": 29,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-05-02T06:08:00",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "***Have you heard of magic dice in steem platform,which doubles your STEEM and SBD.I have doubled 2000 STEEM (see my Steem Power as proof)check this link and register to double your STEEM/SBD. https://bit.ly/magicdice2"
    }
  ]
}
autosteem.comsent 0.001 STEEM to @lucydico- "Finally, STEEM BOT, everyone can use. Run your own BOT or order autoSTEEM BOT service for stressless passive daily STEEM/SBD returns based on your investment. For more info, go to https://autosteem.co..."
2019/05/01 13:05:36
fromautosteem.com
tolucydico
amount0.001 STEEM
memoFinally, STEEM BOT, everyone can use. Run your own BOT or order autoSTEEM BOT service for stressless passive daily STEEM/SBD returns based on your investment. For more info, go to https://autosteem.com/product/autosteem-bid-bot/?steemit. Also, don't forget to join us on Discord: https://discord.gg/K4qvwFM
Transaction InfoBlock #32526688/Trx 9bd3a97537f8fcfcdc65616391fc39ae2d67d6fc
View Raw JSON Data
{
  "trx_id": "9bd3a97537f8fcfcdc65616391fc39ae2d67d6fc",
  "block": 32526688,
  "trx_in_block": 11,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-05-01T13:05:36",
  "op": [
    "transfer",
    {
      "from": "autosteem.com",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "Finally, STEEM BOT, everyone can use. Run your own BOT or order autoSTEEM BOT service for stressless passive daily STEEM/SBD returns based on your investment. For more info, go to https://autosteem.com/product/autosteem-bid-bot/?steemit. Also, don't forget to join us on Discord: https://discord.gg/K4qvwFM"
    }
  ]
}
2019/01/30 01:20:21
parent authorlucydico
parent permlinkpress-release-lucyd-launches-first-prescription-audio-glasses
authorsteemitboard
permlinksteemitboard-notify-lucydico-20190130t012021000z
title
bodyCongratulations @lucydico! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@lucydico/birthday1.png</td><td>Happy Birthday! - You are on the Steem blockchain for 1 year!</td></tr></table> <sub>_[Click here to view your Board](https://steemitboard.com/@lucydico)_</sub> > Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #29895150/Trx a803285d93e0ed7ba90c965c416f50a980751d92
View Raw JSON Data
{
  "trx_id": "a803285d93e0ed7ba90c965c416f50a980751d92",
  "block": 29895150,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-01-30T01:20:21",
  "op": [
    "comment",
    {
      "parent_author": "lucydico",
      "parent_permlink": "press-release-lucyd-launches-first-prescription-audio-glasses",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-lucydico-20190130t012021000z",
      "title": "",
      "body": "Congratulations @lucydico! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@lucydico/birthday1.png</td><td>Happy Birthday! - You are on the Steem blockchain for 1 year!</td></tr></table>\n\n<sub>_[Click here to view your Board](https://steemitboard.com/@lucydico)_</sub>\n\n\n> Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2018/12/25 18:09:57
voterlucydico
authoromniloquent
permlinkmerry-christmas-followers
weight10000 (100.00%)
Transaction InfoBlock #28879474/Trx ffac8e55145163f3346de4d182e426ff78c8a826
View Raw JSON Data
{
  "trx_id": "ffac8e55145163f3346de4d182e426ff78c8a826",
  "block": 28879474,
  "trx_in_block": 21,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-12-25T18:09:57",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "merry-christmas-followers",
      "weight": 10000
    }
  ]
}
merlin7sent 0.001 STEEM to @lucydico- "***Have you heard of magic dice in steem platform,which doubles your STEEM and SBD,check this link and register to double your STEEM/SBD https://bit.ly/magicdice2"
2018/12/17 08:11:06
frommerlin7
tolucydico
amount0.001 STEEM
memo***Have you heard of magic dice in steem platform,which doubles your STEEM and SBD,check this link and register to double your STEEM/SBD https://bit.ly/magicdice2
Transaction InfoBlock #28637256/Trx b6661a0d27b07ca873bb2e3f26d32f4241027099
View Raw JSON Data
{
  "trx_id": "b6661a0d27b07ca873bb2e3f26d32f4241027099",
  "block": 28637256,
  "trx_in_block": 27,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-12-17T08:11:06",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "***Have you heard of magic dice in steem platform,which doubles your STEEM and SBD,check this link and register to double your STEEM/SBD  https://bit.ly/magicdice2"
    }
  ]
}
merlin7sent 0.001 STEEM to @lucydico- "↗↗∑Merlin7®≫ raises-∞ -up + Get return of 100’s of VALUED UPVOTES from esteemed HIGH REPUTATION accounts since Merlin7 upvotes them daily. Promote your post with nearly 76,000 Following+ 19000 “ACTIVE..."
2018/12/12 13:10:51
frommerlin7
tolucydico
amount0.001 STEEM
memo↗↗∑Merlin7®≫ raises-∞ -up + Get return of 100’s of VALUED UPVOTES from esteemed HIGH REPUTATION accounts since Merlin7 upvotes them daily. Promote your post with nearly 76,000 Following+ 19000 “ACTIVE “(collaborated) followers, send 1.5 SBD to 2SBD to 2.5SBD to 3SBD to 4SBD to 5 SBD according to service needed.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 (70,800 SP) will resteem your post . Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 20 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 25 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 SBD ◀◀│More than 30 customers above reputation 60 prefer this service** Merlin7 ranks** 2** in TOP CURATORS OF STEEMIT https://steemit.com/bisteemit/@boddhistats/tasteem-top-200-effective-curators-for-the-last-week-2018-11-12-2018-11-18
Transaction InfoBlock #28499341/Trx 4d5e1a515a3b5174ab71c0df9c760caa97ebd2c2
View Raw JSON Data
{
  "trx_id": "4d5e1a515a3b5174ab71c0df9c760caa97ebd2c2",
  "block": 28499341,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-12-12T13:10:51",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "↗↗∑Merlin7®≫ raises-∞ -up + Get return of 100’s of VALUED UPVOTES from esteemed HIGH REPUTATION accounts since Merlin7 upvotes them daily. Promote your post with nearly 76,000 Following+ 19000 “ACTIVE “(collaborated) followers, send 1.5 SBD to 2SBD to 2.5SBD to 3SBD to 4SBD to 5 SBD  according to service needed.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 (70,800 SP) will resteem your post . Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 20 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 25 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 SBD ◀◀│More than 30 customers  above reputation 60 prefer this service** Merlin7 ranks** 2** in TOP CURATORS OF STEEMIT  https://steemit.com/bisteemit/@boddhistats/tasteem-top-200-effective-curators-for-the-last-week-2018-11-12-2018-11-18"
    }
  ]
}
2018/12/10 19:37:57
voterlucydico
authoromniloquent
permlinkcrypto-bear-market-continues
weight10000 (100.00%)
Transaction InfoBlock #28449516/Trx caf40048c5a703ce54350476b4a508363176e98d
View Raw JSON Data
{
  "trx_id": "caf40048c5a703ce54350476b4a508363176e98d",
  "block": 28449516,
  "trx_in_block": 41,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-12-10T19:37:57",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "crypto-bear-market-continues",
      "weight": 10000
    }
  ]
}
2018/11/26 22:06:06
voterlucydico
authoromniloquent
permlinklast-time-oil-was-like-this-was-before-the-recession-in-2008
weight10000 (100.00%)
Transaction InfoBlock #28049455/Trx 747f0ee3e818c312a67f933fd004ec09a349a1c8
View Raw JSON Data
{
  "trx_id": "747f0ee3e818c312a67f933fd004ec09a349a1c8",
  "block": 28049455,
  "trx_in_block": 27,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-26T22:06:06",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "last-time-oil-was-like-this-was-before-the-recession-in-2008",
      "weight": 10000
    }
  ]
}
2018/11/22 14:42:18
voterlucydico
authoromniloquent
permlinkit-s-all-a-game-that-they-play
weight10000 (100.00%)
Transaction InfoBlock #27925465/Trx 49b23b23b0158497ce49a55786e169ab3d3d9b8c
View Raw JSON Data
{
  "trx_id": "49b23b23b0158497ce49a55786e169ab3d3d9b8c",
  "block": 27925465,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-22T14:42:18",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "it-s-all-a-game-that-they-play",
      "weight": 10000
    }
  ]
}
2018/11/18 05:50:18
voterlucydico
authoromniloquent
permlinkcapitalism-is-a-ponzi
weight10000 (100.00%)
Transaction InfoBlock #27799662/Trx c37e5248b6074dea6132cf0c0e72cf43dd2a8ee1
View Raw JSON Data
{
  "trx_id": "c37e5248b6074dea6132cf0c0e72cf43dd2a8ee1",
  "block": 27799662,
  "trx_in_block": 9,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-18T05:50:18",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "capitalism-is-a-ponzi",
      "weight": 10000
    }
  ]
}
abcorsent 0.001 STEEM to @lucydico- "📌📌📌 PROMOTION SERVICE 📌📌📌 Send 3 SBD and you will get 200+ votes per post in your next 10 posts and resteem to my 10.000+ followes or send 0.4 SBD for 1 post."
2018/11/13 10:01:24
fromabcor
tolucydico
amount0.001 STEEM
memo📌📌📌 PROMOTION SERVICE 📌📌📌 Send 3 SBD and you will get 200+ votes per post in your next 10 posts and resteem to my 10.000+ followes or send 0.4 SBD for 1 post.
Transaction InfoBlock #27660793/Trx e163f5ae0d75c8fbde1223fe77a67927c0aa83d0
View Raw JSON Data
{
  "trx_id": "e163f5ae0d75c8fbde1223fe77a67927c0aa83d0",
  "block": 27660793,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-13T10:01:24",
  "op": [
    "transfer",
    {
      "from": "abcor",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "📌📌📌 PROMOTION SERVICE 📌📌📌 Send 3 SBD and you will get 200+ votes per post in your next 10 posts and resteem to my 10.000+ followes or send 0.4 SBD for 1 post."
    }
  ]
}
2018/11/09 16:52:27
voterlucydico
authoromniloquent
permlinkwhatsupwiththebuffetbuyback-hm3osk7zzg
weight10000 (100.00%)
Transaction InfoBlock #27553875/Trx fa9ec2333cdff92acc0e95f6dd8e99cad9f0b2bc
View Raw JSON Data
{
  "trx_id": "fa9ec2333cdff92acc0e95f6dd8e99cad9f0b2bc",
  "block": 27553875,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-09T16:52:27",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "whatsupwiththebuffetbuyback-hm3osk7zzg",
      "weight": 10000
    }
  ]
}
lucydicoreceived 3.710 STEEM from power down installment (4.594 SP)
2018/11/07 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.710 STEEM
Transaction InfoBlock #27491962/Virtual Operation #10
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 27491962,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 10,
  "timestamp": "2018-11-07T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.710 STEEM"
    }
  ]
}
2018/11/04 16:00:21
voterlucydico
authoromniloquent
permlinkeurotoreplacethedollar-459o2sbm9q
weight10000 (100.00%)
Transaction InfoBlock #27408958/Trx 59cf8aaed88b6cbc0f684c8afe84606b42a9065f
View Raw JSON Data
{
  "trx_id": "59cf8aaed88b6cbc0f684c8afe84606b42a9065f",
  "block": 27408958,
  "trx_in_block": 36,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-04T16:00:21",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "eurotoreplacethedollar-459o2sbm9q",
      "weight": 10000
    }
  ]
}
2018/11/03 20:31:39
voterlucydico
authoromniloquent
permlinkcancryptocurrencysurviveagobalfinancialcrisis-a5wy23x1e6
weight10000 (100.00%)
Transaction InfoBlock #27385613/Trx 0fc948a960d949a88a08063f8a7b40c231a4ffa1
View Raw JSON Data
{
  "trx_id": "0fc948a960d949a88a08063f8a7b40c231a4ffa1",
  "block": 27385613,
  "trx_in_block": 12,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-11-03T20:31:39",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "cancryptocurrencysurviveagobalfinancialcrisis-a5wy23x1e6",
      "weight": 10000
    }
  ]
}
merlin7sent 0.001 STEEM to @lucydico- "=>Grow Fast in less time, promote your post with nearly 76,000 Following+ 19000 active (collaborated) followers, send 1.5 SBD/2STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM to 3SBD/4STEEM to 4SBD/5STEEM ac..."
2018/10/31 18:29:30
frommerlin7
tolucydico
amount0.001 STEEM
memo=>Grow Fast in less time, promote your post with nearly 76,000 Following+ 19000 active (collaborated) followers, send 1.5 SBD/2STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM to 3SBD/4STEEM to 4SBD/5STEEM according to service needed.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 51,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 20 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 25 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers above reputation 60 prefer this service** Merlin7 ranks** 07** in TOP CURATORS OF STEEMIT https://steemit.com/bisteemit/@boddhisattva/top-200-effective-steemit-curators-in-cn-category-for-the-last-week-2018-09-24-2018-09-30
Transaction InfoBlock #27296826/Trx a7a61a5123efaa96904107b173327d5819f63f58
View Raw JSON Data
{
  "trx_id": "a7a61a5123efaa96904107b173327d5819f63f58",
  "block": 27296826,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-31T18:29:30",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "=>Grow Fast in less time, promote your post with nearly 76,000 Following+ 19000 active (collaborated) followers, send  1.5 SBD/2STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM to 3SBD/4STEEM to 4SBD/5STEEM according to service needed.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 51,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 20 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 25 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers  above reputation 60 prefer this service** Merlin7 ranks** 07** in TOP CURATORS OF STEEMIT https://steemit.com/bisteemit/@boddhisattva/top-200-effective-steemit-curators-in-cn-category-for-the-last-week-2018-09-24-2018-09-30"
    }
  ]
}
lucydicoreceived 3.709 STEEM from power down installment (4.594 SP)
2018/10/31 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.709 STEEM
Transaction InfoBlock #27290534/Virtual Operation #2
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 27290534,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 2,
  "timestamp": "2018-10-31T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.709 STEEM"
    }
  ]
}
2018/10/31 09:11:39
voterlucydico
authoromniloquent
permlinkde-dollarizationisonitsway-mmc2ggymi1
weight10000 (100.00%)
Transaction InfoBlock #27285673/Trx 63322cba0fea1e0cf3e73f9fd5ce04f2c2d5bd11
View Raw JSON Data
{
  "trx_id": "63322cba0fea1e0cf3e73f9fd5ce04f2c2d5bd11",
  "block": 27285673,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-31T09:11:39",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "de-dollarizationisonitsway-mmc2ggymi1",
      "weight": 10000
    }
  ]
}
2018/10/28 12:21:30
voterlucydico
authoromniloquent
permlinksidewaysmarketwaitingforacatalyst-nnbwgbaqb0
weight10000 (100.00%)
Transaction InfoBlock #27203130/Trx db49d1c3a284c334d38a7bfd886e80289197ab03
View Raw JSON Data
{
  "trx_id": "db49d1c3a284c334d38a7bfd886e80289197ab03",
  "block": 27203130,
  "trx_in_block": 42,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-28T12:21:30",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "sidewaysmarketwaitingforacatalyst-nnbwgbaqb0",
      "weight": 10000
    }
  ]
}
2018/10/26 18:41:21
voterlucydico
authoromniloquent
permlinkglobalmarketsaregettingvolatileastradespatscontinue-80g259d1ba
weight10000 (100.00%)
Transaction InfoBlock #27153160/Trx 41ab6544bc5bec722ac6e66dbaa1bd52a2222f98
View Raw JSON Data
{
  "trx_id": "41ab6544bc5bec722ac6e66dbaa1bd52a2222f98",
  "block": 27153160,
  "trx_in_block": 11,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-26T18:41:21",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "globalmarketsaregettingvolatileastradespatscontinue-80g259d1ba",
      "weight": 10000
    }
  ]
}
abcorsent 0.001 STEEM to @lucydico- "📌📌📌 PROMOTION SERVICE 📌📌📌 Send 3 SBD and you will get 100+ votes per post in your next 10 posts and resteem to my 10.000+ followes or send 0.4 SBD for 1 post."
2018/10/26 09:18:33
fromabcor
tolucydico
amount0.001 STEEM
memo📌📌📌 PROMOTION SERVICE 📌📌📌 Send 3 SBD and you will get 100+ votes per post in your next 10 posts and resteem to my 10.000+ followes or send 0.4 SBD for 1 post.
Transaction InfoBlock #27141911/Trx 250940bbf3983b5af251442b8da01e77a7c45ef1
View Raw JSON Data
{
  "trx_id": "250940bbf3983b5af251442b8da01e77a7c45ef1",
  "block": 27141911,
  "trx_in_block": 16,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-26T09:18:33",
  "op": [
    "transfer",
    {
      "from": "abcor",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "📌📌📌 PROMOTION SERVICE 📌📌📌 Send 3 SBD and you will get 100+ votes per post in your next 10 posts and resteem to my 10.000+ followes or send 0.4 SBD for 1 post."
    }
  ]
}
lucydicoreceived 3.707 STEEM from power down installment (4.594 SP)
2018/10/24 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.707 STEEM
Transaction InfoBlock #27089078/Virtual Operation #23
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 27089078,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 23,
  "timestamp": "2018-10-24T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.707 STEEM"
    }
  ]
}
merlin7sent 0.001 STEEM to @lucydico- "=>Grow Fast in less time, promote your post with nearly 69,000 Following+ 19000 active (collaborated) followers, send 1.5 SBD/2STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM to 3SBD/4STEEM to 4SBD/5STEEM ac..."
2018/10/20 06:32:45
frommerlin7
tolucydico
amount0.001 STEEM
memo=>Grow Fast in less time, promote your post with nearly 69,000 Following+ 19000 active (collaborated) followers, send 1.5 SBD/2STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM to 3SBD/4STEEM to 4SBD/5STEEM according to service needed.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 51,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 20 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 25 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers above reputation 60 prefer this service** Merlin7 ranks** 07** in TOP CURATORS OF STEEMIT https://steemit.com/bisteemit/@boddhisattva/top-200-effective-steemit-curators-in-cn-category-for-the-last-week-2018-09-24-2018-09-30
Transaction InfoBlock #26965927/Trx fa8b253406282ebc9f0ad4d165f214039a1c94db
View Raw JSON Data
{
  "trx_id": "fa8b253406282ebc9f0ad4d165f214039a1c94db",
  "block": 26965927,
  "trx_in_block": 13,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-20T06:32:45",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "=>Grow Fast in less time, promote your post with nearly 69,000 Following+ 19000 active (collaborated) followers, send  1.5 SBD/2STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM to 3SBD/4STEEM to 4SBD/5STEEM according to service needed.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 51,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 20 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 25 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers  above reputation 60 prefer this service** Merlin7 ranks** 07** in TOP CURATORS OF STEEMIT https://steemit.com/bisteemit/@boddhisattva/top-200-effective-steemit-curators-in-cn-category-for-the-last-week-2018-09-24-2018-09-30"
    }
  ]
}
lucydicoreceived 3.706 STEEM from power down installment (4.594 SP)
2018/10/17 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.706 STEEM
Transaction InfoBlock #26887616/Virtual Operation #14
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 26887616,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 14,
  "timestamp": "2018-10-17T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.706 STEEM"
    }
  ]
}
lucydicoreceived 3.705 STEEM from power down installment (4.594 SP)
2018/10/10 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.705 STEEM
Transaction InfoBlock #26686196/Virtual Operation #53
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 26686196,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 53,
  "timestamp": "2018-10-10T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.705 STEEM"
    }
  ]
}
2018/10/03 19:44:00
voterlucydico
authoromniloquent
permlinkbitcoinisstartingtoshowsomefundamentals-zevpo2ogtg
weight10000 (100.00%)
Transaction InfoBlock #26492498/Trx 590c55bb60a371b8fdd3add72de217c388a1a812
View Raw JSON Data
{
  "trx_id": "590c55bb60a371b8fdd3add72de217c388a1a812",
  "block": 26492498,
  "trx_in_block": 19,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-03T19:44:00",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "bitcoinisstartingtoshowsomefundamentals-zevpo2ogtg",
      "weight": 10000
    }
  ]
}
lucydicoreceived 3.703 STEEM from power down installment (4.594 SP)
2018/10/03 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.703 STEEM
Transaction InfoBlock #26484716/Virtual Operation #3
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 26484716,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 3,
  "timestamp": "2018-10-03T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.703 STEEM"
    }
  ]
}
lucydicoreceived 3.702 STEEM from power down installment (4.594 SP)
2018/09/26 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.702 STEEM
Transaction InfoBlock #26283285/Virtual Operation #5
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 26283285,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 5,
  "timestamp": "2018-09-26T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.702 STEEM"
    }
  ]
}
2018/09/24 20:14:33
voterlucydico
authoromniloquent
permlinkwriters-wanted
weight10000 (100.00%)
Transaction InfoBlock #26234253/Trx aa3a663b1410d9a2f26649f094bc9b63749ea3cc
View Raw JSON Data
{
  "trx_id": "aa3a663b1410d9a2f26649f094bc9b63749ea3cc",
  "block": 26234253,
  "trx_in_block": 30,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-24T20:14:33",
  "op": [
    "vote",
    {
      "voter": "lucydico",
      "author": "omniloquent",
      "permlink": "writers-wanted",
      "weight": 10000
    }
  ]
}
lucydicoreceived 3.700 STEEM from power down installment (4.594 SP)
2018/09/19 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.700 STEEM
Transaction InfoBlock #26081998/Virtual Operation #4
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 26081998,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 4,
  "timestamp": "2018-09-19T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.700 STEEM"
    }
  ]
}
2018/09/13 06:22:21
voterindiahealth
authorlucydico
permlinkpress-release-lucyd-launches-first-prescription-audio-glasses
weight10000 (100.00%)
Transaction InfoBlock #25916582/Trx b67e5cc88cc371c6b8b237121898f2c7c4e4444d
View Raw JSON Data
{
  "trx_id": "b67e5cc88cc371c6b8b237121898f2c7c4e4444d",
  "block": 25916582,
  "trx_in_block": 34,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-13T06:22:21",
  "op": [
    "vote",
    {
      "voter": "indiahealth",
      "author": "lucydico",
      "permlink": "press-release-lucyd-launches-first-prescription-audio-glasses",
      "weight": 10000
    }
  ]
}
2018/09/13 06:15:57
parent author
parent permlinklucyd
authorlucydico
permlinkpress-release-lucyd-launches-first-prescription-audio-glasses
titlePress Release: Lucyd Launches First Prescription Audio Glasses
body![](https://cdn.steemitimages.com/DQmRWzQuU18NpbLhJZXxQfjTLWkWWouK2GpyCPPJUbqPF9i/image.png) #getLOUD Hey #lucydfam! You know our mission is to gather and develop the greatest innovations in eyewear. The first major step we are taking to that goal is the release of the Lucyd Loud beta at lucyd.co. This is the first time bluetooth audio glasses are available in prescription. Well over half of the world population need some level of corrective lens to see clearly. This is why we are focused on smartglasses that can accommodate prescription — because without it, they are unusable for so many people. Read the release about Lucyd Loud here: https://www.prnewswire.com/news-releases/lucyd-releases-the-first-prescription-compatible-smart-glasses-300711038.html SINGAPORE, Sept. 12, 2018 /PRNewswire/ -- Lucyd Pte LTD. has recently released their first product, Lucyd Loud, the… www.prnewswire.com If you’d like to try the beta, save 15% with code 3RDEYE at checkout. Additionally, you can submit a 300+ word review of Lucyd Loud to [email protected] for a coupon for 35% off your next pair of glasses. This is just our way of encouraging the community to try Loud and give us your feedback to make it better. That’s all for now, take care and stay posted here or on the Lucyd blog for great new content on the AR world.
json metadata{"tags":["lucyd","virtualreality","tech","news","interesting"],"image":["https://cdn.steemitimages.com/DQmRWzQuU18NpbLhJZXxQfjTLWkWWouK2GpyCPPJUbqPF9i/image.png"],"links":["https://www.prnewswire.com/news-releases/lucyd-releases-the-first-prescription-compatible-smart-glasses-300711038.html"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25916454/Trx ae72adf58aae9adfd5b050d8a32d351b186913e6
View Raw JSON Data
{
  "trx_id": "ae72adf58aae9adfd5b050d8a32d351b186913e6",
  "block": 25916454,
  "trx_in_block": 53,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-13T06:15:57",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "lucyd",
      "author": "lucydico",
      "permlink": "press-release-lucyd-launches-first-prescription-audio-glasses",
      "title": "Press Release: Lucyd Launches First Prescription Audio Glasses",
      "body": "![](https://cdn.steemitimages.com/DQmRWzQuU18NpbLhJZXxQfjTLWkWWouK2GpyCPPJUbqPF9i/image.png)\n#getLOUD\n\nHey #lucydfam! You know our mission is to gather and develop the greatest innovations in eyewear. The first major step we are taking to that goal is the release of the Lucyd Loud beta at lucyd.co. This is the first time bluetooth audio glasses are available in prescription. Well over half of the world population need some level of corrective lens to see clearly. This is why we are focused on smartglasses that can accommodate prescription — because without it, they are unusable for so many people.\n\nRead the release about Lucyd Loud here: https://www.prnewswire.com/news-releases/lucyd-releases-the-first-prescription-compatible-smart-glasses-300711038.html\n\nSINGAPORE, Sept. 12, 2018 /PRNewswire/ -- Lucyd Pte LTD. has recently released their first product, Lucyd Loud, the…\nwww.prnewswire.com\n\nIf you’d like to try the beta, save 15% with code 3RDEYE at checkout. Additionally, you can submit a 300+ word review of Lucyd Loud to [email protected] for a coupon for 35% off your next pair of glasses. This is just our way of encouraging the community to try Loud and give us your feedback to make it better.\n\nThat’s all for now, take care and stay posted here or on the Lucyd blog for great new content on the AR world.",
      "json_metadata": "{\"tags\":[\"lucyd\",\"virtualreality\",\"tech\",\"news\",\"interesting\"],\"image\":[\"https://cdn.steemitimages.com/DQmRWzQuU18NpbLhJZXxQfjTLWkWWouK2GpyCPPJUbqPF9i/image.png\"],\"links\":[\"https://www.prnewswire.com/news-releases/lucyd-releases-the-first-prescription-compatible-smart-glasses-300711038.html\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
lucydicoreceived 3.699 STEEM from power down installment (4.594 SP)
2018/09/12 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.699 STEEM
Transaction InfoBlock #25896036/Virtual Operation #18
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 25896036,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 18,
  "timestamp": "2018-09-12T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.699 STEEM"
    }
  ]
}
2018/09/09 22:26:39
votergnusmas
authorlucydico
permlinkutility-company-develops-an-ar-solution-to-its-complex-technical-problems
weight10000 (100.00%)
Transaction InfoBlock #25820696/Trx b2dacb4d15b588dd0f83b7dfe7c70c89401309da
View Raw JSON Data
{
  "trx_id": "b2dacb4d15b588dd0f83b7dfe7c70c89401309da",
  "block": 25820696,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-09T22:26:39",
  "op": [
    "vote",
    {
      "voter": "gnusmas",
      "author": "lucydico",
      "permlink": "utility-company-develops-an-ar-solution-to-its-complex-technical-problems",
      "weight": 10000
    }
  ]
}
2018/09/09 22:26:36
parent authorlucydico
parent permlinkutility-company-develops-an-ar-solution-to-its-complex-technical-problems
authorgnusmas
permlinkre-lucydico-utility-company-develops-an-ar-solution-to-its-complex-technical-problems-20180909t222638440z
title
bodyit would be great but I think it's just a dream
json metadata{"tags":["technology"],"app":"steemit/0.1"}
Transaction InfoBlock #25820695/Trx a4421c788c131ca3102635556d0f4555033e18ed
View Raw JSON Data
{
  "trx_id": "a4421c788c131ca3102635556d0f4555033e18ed",
  "block": 25820695,
  "trx_in_block": 28,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-09T22:26:36",
  "op": [
    "comment",
    {
      "parent_author": "lucydico",
      "parent_permlink": "utility-company-develops-an-ar-solution-to-its-complex-technical-problems",
      "author": "gnusmas",
      "permlink": "re-lucydico-utility-company-develops-an-ar-solution-to-its-complex-technical-problems-20180909t222638440z",
      "title": "",
      "body": "it would be great but I think it's just a dream",
      "json_metadata": "{\"tags\":[\"technology\"],\"app\":\"steemit/0.1\"}"
    }
  ]
}
2018/09/09 22:21:27
parent author
parent permlinktechnology
authorlucydico
permlinkutility-company-develops-an-ar-solution-to-its-complex-technical-problems
titleUtility Company Develops An AR Solution To Its Complex Technical Problems
body![](https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png) Imagine a future where technical jobs require minimal education. Instead of technicians needing to know what every transistor and dial does in a piece of machinery, they simply point their smartphone camera at an exposed wiring panel. A digital overlay pops up, tells the tech what needs to be adjusted and why, and the problem is solved. That’s exactly what one utility company, Westar Energy, is building into its infrastructure. When one hears the term, “augmented reality,” it’s not likely that utility companies are the first thing that come to mind. But if there’s one thing companies love, it’s cutting costs. And any time human knowledge and experience can be replaced by software, that’s a massive opportunity for reducing overhead. The application, modestly dubbed the LineAssist SuperApp, is being rolled out to field technicians. It works by walking a tech through a troubleshooter for each specific model of controller. By using augmented reality, it shows the tech exactly what needs to be done to solve a given problem, much like the example above. Not only that, but the app includes reference material for the craftsman to use in case there is a related problem that isn’t explicitly covered by the app itself. While it’s reasonable to expect that it may take some months for all the bugs to be worked out of the program, Westar Energy is likely expecting this push into augmented reality to be well worth the investment. Taking technicians away from their work to drive to a site and work on something complex like a line voltage regulator is time consuming and expensive. If the app manages to cut the frequency with which techs need to drive out and work on the problem themselves, then the program will have paid for itself and then some over the long term. What do you think about Westar Energy’s foray into the augmented reality world? Let us know in a comment!
json metadata{"tags":["technology","medicine","interesting","cool","news"],"image":["https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25820592/Trx df27d04f3328f17cb7c382508981536799b89daa
View Raw JSON Data
{
  "trx_id": "df27d04f3328f17cb7c382508981536799b89daa",
  "block": 25820592,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-09T22:21:27",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "technology",
      "author": "lucydico",
      "permlink": "utility-company-develops-an-ar-solution-to-its-complex-technical-problems",
      "title": "Utility Company Develops An AR Solution To Its Complex Technical Problems",
      "body": "![](https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png)\n\nImagine a future where technical jobs require minimal education. Instead of technicians needing to know what every transistor and dial does in a piece of machinery, they simply point their smartphone camera at an exposed wiring panel. A digital overlay pops up, tells the tech what needs to be adjusted and why, and the problem is solved.\n\nThat’s exactly what one utility company, Westar Energy, is building into its infrastructure.\n\nWhen one hears the term, “augmented reality,” it’s not likely that utility companies are the first thing that come to mind. But if there’s one thing companies love, it’s cutting costs. And any time human knowledge and experience can be replaced by software, that’s a massive opportunity for reducing overhead.\n\nThe application, modestly dubbed the LineAssist SuperApp, is being rolled out to field technicians. It works by walking a tech through a troubleshooter for each specific model of controller. By using augmented reality, it shows the tech exactly what needs to be done to solve a given problem, much like the example above.\n\nNot only that, but the app includes reference material for the craftsman to use in case there is a related problem that isn’t explicitly covered by the app itself.\n\nWhile it’s reasonable to expect that it may take some months for all the bugs to be worked out of the program, Westar Energy is likely expecting this push into augmented reality to be well worth the investment. Taking technicians away from their work to drive to a site and work on something complex like a line voltage regulator is time consuming and expensive. If the app manages to cut the frequency with which techs need to drive out and work on the problem themselves, then the program will have paid for itself and then some over the long term.\n\nWhat do you think about Westar Energy’s foray into the augmented reality world? Let us know in a comment!",
      "json_metadata": "{\"tags\":[\"technology\",\"medicine\",\"interesting\",\"cool\",\"news\"],\"image\":[\"https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/09/08 21:02:09
votertainika
authorlucydico
permlinkartist-in-miami-raises-awareness-about-climate-change-through-clever-a
weight200 (2.00%)
Transaction InfoBlock #25790209/Trx 1391fb5455ba8c215283c559eeba3ef58d2bc809
View Raw JSON Data
{
  "trx_id": "1391fb5455ba8c215283c559eeba3ef58d2bc809",
  "block": 25790209,
  "trx_in_block": 12,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T21:02:09",
  "op": [
    "vote",
    {
      "voter": "tainika",
      "author": "lucydico",
      "permlink": "artist-in-miami-raises-awareness-about-climate-change-through-clever-a",
      "weight": 200
    }
  ]
}
2018/09/08 21:02:00
voterdmiton
authorlucydico
permlinkartist-in-miami-raises-awareness-about-climate-change-through-clever-a
weight200 (2.00%)
Transaction InfoBlock #25790206/Trx 6f0d813e377659f827d02cedafb6a2ecbae45810
View Raw JSON Data
{
  "trx_id": "6f0d813e377659f827d02cedafb6a2ecbae45810",
  "block": 25790206,
  "trx_in_block": 21,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T21:02:00",
  "op": [
    "vote",
    {
      "voter": "dmiton",
      "author": "lucydico",
      "permlink": "artist-in-miami-raises-awareness-about-climate-change-through-clever-a",
      "weight": 200
    }
  ]
}
2018/09/08 21:01:27
voterhitmanchoi
authorlucydico
permlinkartist-in-miami-raises-awareness-about-climate-change-through-clever-a
weight2000 (20.00%)
Transaction InfoBlock #25790195/Trx e2c7ce6c51da244425e1d0192969e310e8bc697e
View Raw JSON Data
{
  "trx_id": "e2c7ce6c51da244425e1d0192969e310e8bc697e",
  "block": 25790195,
  "trx_in_block": 13,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T21:01:27",
  "op": [
    "vote",
    {
      "voter": "hitmanchoi",
      "author": "lucydico",
      "permlink": "artist-in-miami-raises-awareness-about-climate-change-through-clever-a",
      "weight": 2000
    }
  ]
}
2018/09/08 20:30:51
parent author
parent permlinknews
authorlucydico
permlinkartist-in-miami-raises-awareness-about-climate-change-through-clever-a
titleArtist In Miami Raises Awareness About Climate Change Through Clever A
body![](https://cdn.steemitimages.com/DQmYUkm9gH6GDLPv6QWnjHMHWMijxJwzD5TRCeQVsuBxX8A/image.png) Image credit: Before It’s Too Late The way things are going now, it’s only a matter of time before augmented reality permeates every aspect of our lives, just like smartphones. It’s likely that the only thing preventing this mass adoption is the availability and sophistication of the development tools to create for the medium. That said, one of the fastest ways to develop a new method of conveying information is through art. Television and the internet proved that art, and consequently advertising, can be a driving factor in adoption of new technology. Better shows means more people watching TV. And more people watching TV means more advertising dollars. And more advertising dollars means better TV. It’s a cycle. Fans of mixed reality then should be happy to see the Miami-based artist Linda Cheung creating an augmented reality mural project that taps into the emotional aspect of climate change. Already a politically-charged issue, you’re unlikely to find anyone on the planet who doesn’t have an opinion about this sensitive subject. From a marketing perspective, Cheung’s choice to focus on climate change for her exhibit is brilliant. Users are treated to an interactive experience when they look at Cheung’s exhibit through their smartphone. A play on the classic “Miami” sign, Linda’s version features a massive Xanax tablet where the “I” would be along with an “M” covered in gaudy diamonds. Users can then choose whether or not to make a change towards the attitude of climate change. If they select “make no change,” then they’re treated to a dystopian future with collapsed buildings covered in overgrowth. If they choose “be the change,” then the future looks more promising — renewable energy sources and clean streets are their reward. The exhibit is meant to evoke thought and emotion around the topic of climate change. Regardless of where individuals stand on the topic, the fact remains that through Cheung’s clever use of augmented reality, more people are being exposed to the subject than would have been otherwise. And for the augmented reality as a whole, that’s a good thing. What do you think about Linda Cheung’s augmented reality art exhibit in Miami? Let us know in a comment!
json metadata{"tags":["news","interesting","miami","cool","art"],"image":["https://cdn.steemitimages.com/DQmYUkm9gH6GDLPv6QWnjHMHWMijxJwzD5TRCeQVsuBxX8A/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25789583/Trx a2e48332fb596d84964d40adc2366c8071a2f975
View Raw JSON Data
{
  "trx_id": "a2e48332fb596d84964d40adc2366c8071a2f975",
  "block": 25789583,
  "trx_in_block": 16,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T20:30:51",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "news",
      "author": "lucydico",
      "permlink": "artist-in-miami-raises-awareness-about-climate-change-through-clever-a",
      "title": "Artist In Miami Raises Awareness About Climate Change Through Clever A",
      "body": "![](https://cdn.steemitimages.com/DQmYUkm9gH6GDLPv6QWnjHMHWMijxJwzD5TRCeQVsuBxX8A/image.png)\nImage credit: Before It’s Too Late\n\nThe way things are going now, it’s only a matter of time before augmented reality permeates every aspect of our lives, just like smartphones. It’s likely that the only thing preventing this mass adoption is the availability and sophistication of the development tools to create for the medium.\n\nThat said, one of the fastest ways to develop a new method of conveying information is through art. Television and the internet proved that art, and consequently advertising, can be a driving factor in adoption of new technology. Better shows means more people watching TV. And more people watching TV means more advertising dollars. And more advertising dollars means better TV. It’s a cycle.\n\nFans of mixed reality then should be happy to see the Miami-based artist Linda Cheung creating an augmented reality mural project that taps into the emotional aspect of climate change. Already a politically-charged issue, you’re unlikely to find anyone on the planet who doesn’t have an opinion about this sensitive subject.\n\nFrom a marketing perspective, Cheung’s choice to focus on climate change for her exhibit is brilliant. Users are treated to an interactive experience when they look at Cheung’s exhibit through their smartphone. A play on the classic “Miami” sign, Linda’s version features a massive Xanax tablet where the “I” would be along with an “M” covered in gaudy diamonds. \n\nUsers can then choose whether or not to make a change towards the attitude of climate change. If they select “make no change,” then they’re treated to a dystopian future with collapsed buildings covered in overgrowth. If they choose “be the change,” then the future looks more promising — renewable energy sources and clean streets are their reward. \n\nThe exhibit is meant to evoke thought and emotion around the topic of climate change. Regardless of where individuals stand on the topic, the fact remains that through Cheung’s clever use of augmented reality, more people are being exposed to the subject than would have been otherwise. And for the augmented reality as a whole, that’s a good thing.\n\nWhat do you think about Linda Cheung’s augmented reality art exhibit in Miami? Let us know in a comment!",
      "json_metadata": "{\"tags\":[\"news\",\"interesting\",\"miami\",\"cool\",\"art\"],\"image\":[\"https://cdn.steemitimages.com/DQmYUkm9gH6GDLPv6QWnjHMHWMijxJwzD5TRCeQVsuBxX8A/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/09/08 19:34:33
voternfc
authorlucydico
permlink5vpeoa-italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
weight100 (1.00%)
Transaction InfoBlock #25788457/Trx e86364784957625e3caa6bc714ec53d5d4988528
View Raw JSON Data
{
  "trx_id": "e86364784957625e3caa6bc714ec53d5d4988528",
  "block": 25788457,
  "trx_in_block": 34,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:34:33",
  "op": [
    "vote",
    {
      "voter": "nfc",
      "author": "lucydico",
      "permlink": "5vpeoa-italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "weight": 100
    }
  ]
}
2018/09/08 19:31:27
parent author
parent permlinktechnology
authorlucydico
permlink5vpeoa-italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
titleItalian Researchers Develop Augmented Reality Device That Could Potentially Enable Laypeople To Perform Complex Medical Procedures
body![](https://cdn.steemitimages.com/DQmUMiafG7HLHLySzcDTbQ2pc3wrNZFhggyBbdhYMAZtjJu/image.png) Credit: Mayo Clinic Perhaps one of the most frightening things that can happen to a human being is being struck with Alzheimer’s disease. With an estimated 6 million Americans living in facilities that specialize in Alzheimer’s care and an aging Baby Boomer population, it’s possible that we’ll see this human ailment turn into an institutional problem in the next few years. Los Angeles-based Embodied Labs is looking to alleviate some of this pressure with mixed reality. They’ve developed a new program that helps train caregivers by simulating what it would be like to suffer from the disease. Using a VR headset, users are transported to a fictional reality where lights feel too bright, the print on grocery products is fuzzy, and family members openly show frustration with your behavior for reasons you can’t understand. One of the characters in the program, Beatriz, is a 60-something year old math teacher with Alzheimer’s. When users don the headset, they experience what it would like to be in Beatriz’s shoes. For instance, one of the scenes features her on a park bench with her grown daughter. Beatriz gets visibly flustered when she thinks that her daughter has stolen her purse. Later in the simulation, she startled by the sudden movement of a shadow on the wall of her living room accompanied by a loud noise. A few seconds later, we realize that the shadow and noise were just distorted inputs from the ceiling fan. Dr. Neelum Aggarwal of the Rush Alzheimer’s Disease Center, an Advisor to Embodied Labs, had this to say about the project: > You are there and you are observing this and you have a deep sense of feeling of what’s happening. We know when there’s an emotional connection to something, that whole experience is enhanced and virtual reality seems to be able to do this.” When asked about specifically about caregivers, Aggarwal responded: > Caregivers of people with dementia often ask me, ‘What is she feeling? I don’t know what it’s like. My hope is we not only focus on providers and students that will become future physicians but let’s also use this with the caregivers to help them.” With professional training likely to remain one of the chief uses of augmented and virtual reality technology, it’s possible that we’ll see more programs that tackle tough issues like this in the future. And if it’s more effective than traditional training methodologies, then it’s only a matter of time before it replaces them entirely. What do you think of Embodied Labs’ new Alzheimer’s care training program? Let us know in a comment!
json metadata{"tags":["technology","medicine","interesting","cool","news"],"image":["https://cdn.steemitimages.com/DQmUMiafG7HLHLySzcDTbQ2pc3wrNZFhggyBbdhYMAZtjJu/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25788395/Trx 9cfe7a6a38d4f39e235a4c4195ff09ea96f94ddb
View Raw JSON Data
{
  "trx_id": "9cfe7a6a38d4f39e235a4c4195ff09ea96f94ddb",
  "block": 25788395,
  "trx_in_block": 25,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:31:27",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "technology",
      "author": "lucydico",
      "permlink": "5vpeoa-italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "title": "Italian Researchers Develop Augmented Reality Device That Could Potentially Enable Laypeople To Perform Complex Medical Procedures",
      "body": "![](https://cdn.steemitimages.com/DQmUMiafG7HLHLySzcDTbQ2pc3wrNZFhggyBbdhYMAZtjJu/image.png)\nCredit: Mayo Clinic\n\nPerhaps one of the most frightening things that can happen to a human being is being struck with Alzheimer’s disease. With an estimated 6 million Americans living in facilities that specialize in Alzheimer’s care and an aging Baby Boomer population, it’s possible that we’ll see this human ailment turn into an institutional problem in the next few years.\n\nLos Angeles-based Embodied Labs is looking to alleviate some of this pressure with mixed reality.\n\nThey’ve developed a new program that helps train caregivers by simulating what it would be like to suffer from the disease. Using a VR headset, users are transported to a fictional reality where lights feel too bright, the print on grocery products is fuzzy, and family members openly show frustration with your behavior for reasons you can’t understand.\n\nOne of the characters in the program, Beatriz, is a 60-something year old math teacher with Alzheimer’s. When users don the headset, they experience what it would like to be in Beatriz’s shoes.\n\nFor instance, one of the scenes features her on a park bench with her grown daughter. Beatriz gets visibly flustered when she thinks that her daughter has stolen her purse.\n\nLater in the simulation, she startled by the sudden movement of a shadow on the wall of her living room accompanied by a loud noise. A few seconds later, we realize that the shadow and noise were just distorted inputs from the ceiling fan.\n\nDr. Neelum Aggarwal of the Rush Alzheimer’s Disease Center, an Advisor to Embodied Labs, had this to say about the project:\n\n> You are there and you are observing this and you have a deep sense of feeling of what’s happening. We know when there’s an emotional connection to something, that whole experience is enhanced and virtual reality seems to be able to do this.”\n\nWhen asked about specifically about caregivers, Aggarwal responded:\n\n> Caregivers of people with dementia often ask me, ‘What is she feeling? I don’t know what it’s like. My hope is we not only focus on providers and students that will become future physicians but let’s also use this with the caregivers to help them.”\n\nWith professional training likely to remain one of the chief uses of augmented and virtual reality technology, it’s possible that we’ll see more programs that tackle tough issues like this in the future. And if it’s more effective than traditional training methodologies, then it’s only a matter of time before it replaces them entirely.\n\nWhat do you think of Embodied Labs’ new Alzheimer’s care training program? Let us know in a comment!",
      "json_metadata": "{\"tags\":[\"technology\",\"medicine\",\"interesting\",\"cool\",\"news\"],\"image\":[\"https://cdn.steemitimages.com/DQmUMiafG7HLHLySzcDTbQ2pc3wrNZFhggyBbdhYMAZtjJu/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/09/08 19:07:54
voternfc
authorlucydico
permlinkitalian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
weight100 (1.00%)
Transaction InfoBlock #25787924/Trx fd3a423335c839f3bfd2cf1f7c9b9f948214c9c5
View Raw JSON Data
{
  "trx_id": "fd3a423335c839f3bfd2cf1f7c9b9f948214c9c5",
  "block": 25787924,
  "trx_in_block": 1,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:07:54",
  "op": [
    "vote",
    {
      "voter": "nfc",
      "author": "lucydico",
      "permlink": "italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "weight": 100
    }
  ]
}
2018/09/08 19:02:54
votermtengeti
authorlucydico
permlinkitalian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
weight10000 (100.00%)
Transaction InfoBlock #25787824/Trx 922bd67395e37b69c6b7d0ebac98ddadf635d903
View Raw JSON Data
{
  "trx_id": "922bd67395e37b69c6b7d0ebac98ddadf635d903",
  "block": 25787824,
  "trx_in_block": 20,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:02:54",
  "op": [
    "vote",
    {
      "voter": "mtengeti",
      "author": "lucydico",
      "permlink": "italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "weight": 10000
    }
  ]
}
2018/09/08 19:01:57
voterriskainaya
authorlucydico
permlinkitalian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
weight10000 (100.00%)
Transaction InfoBlock #25787805/Trx 547f62238d33e7f9e5b6b17ad563d9ba4988cd97
View Raw JSON Data
{
  "trx_id": "547f62238d33e7f9e5b6b17ad563d9ba4988cd97",
  "block": 25787805,
  "trx_in_block": 11,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:01:57",
  "op": [
    "vote",
    {
      "voter": "riskainaya",
      "author": "lucydico",
      "permlink": "italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "weight": 10000
    }
  ]
}
2018/09/08 19:01:54
voterincomeboss
authorlucydico
permlinkitalian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
weight10000 (100.00%)
Transaction InfoBlock #25787804/Trx 1a5817eeab7cd1db19ab3c1d11aa44a5f8637995
View Raw JSON Data
{
  "trx_id": "1a5817eeab7cd1db19ab3c1d11aa44a5f8637995",
  "block": 25787804,
  "trx_in_block": 13,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:01:54",
  "op": [
    "vote",
    {
      "voter": "incomeboss",
      "author": "lucydico",
      "permlink": "italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "weight": 10000
    }
  ]
}
2018/09/08 19:00:45
parent author
parent permlinktechnology
authorlucydico
permlinkitalian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical
titleItalian Researchers Develop Augmented Reality Device That Could Potentially Enable Laypeople To Perform Complex Medical Procedures
body![](https://cdn.steemitimages.com/DQmV9xZG3PVW3eAWRquhraqXJndypnjtYWmbsMNcDvp85Q5/image.png) In the not so distant future, it’s entirely possible that human beings won’t need to carry any specialized knowledge around in their memory. Much like calculators have erased the need for on-the-fly mathematical calculations, augmented reality programs could replace domain-specific knowledge. While it’s still mostly theoretical at this point, augmented reality enthusiasts around the world are slowly integrating the medium’s unique benefits into their training programs. One team of Italian-based researchers have created augmented reality software that can project 3D models of CT scans directly onto a human body. So far, they’ve only applied this concept to needle insertion — generally a first step in interventional oncology — and found it to be successful within a 5 millimeter range. This may not sound too particularly exciting at first, but fast forward ten years into the future and the implications may be huge. Inserting a needle is a fairly simple task, even for something as complex as cancer surgery. But imagine a future where the entire surgical process was guided by augmented reality. Not only would costs of expensive medical procedures likely drop, but human beings in parts of the world without highly-trained surgeons would still be able to take emergency measures against aggressive cancer. Furthermore, removing the need for ultrasound and CT scans would protect technicians from overexposure to harmful radiation. Marco Solbiati, the creator of the software, explains the benefits of his system: “Efforts have recently been made not only to improve the efficacy of ablative devices, but also to increase the accuracy of image-guiding systems. Several navigation systems have been developed using augmented reality techniques … [that] allow the operator to see 3D virtual objects superimposed upon the real world and not on a different screen.” Currently, Solbiati and his team are working on more ways to make their prototype even better. Such changes include improving the 3D architecture of a patient’s internal organs and reducing the amount of skin markers necessary for aligning the device. Once the device becomes accurate enough, then it’s only a matter of time before advanced medical procedures are no longer something that trained medical professionals who have spent 10 years in medical school are qualified to perform. When will that day come? Likely sooner than we think.
json metadata{"tags":["technology","medicine","interesting","cool","news"],"image":["https://cdn.steemitimages.com/DQmV9xZG3PVW3eAWRquhraqXJndypnjtYWmbsMNcDvp85Q5/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25787781/Trx ac226ee3e2b1a03e8426d2dc13075b2c31ccc054
View Raw JSON Data
{
  "trx_id": "ac226ee3e2b1a03e8426d2dc13075b2c31ccc054",
  "block": 25787781,
  "trx_in_block": 24,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T19:00:45",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "technology",
      "author": "lucydico",
      "permlink": "italian-researchers-develop-augmented-reality-device-that-could-potentially-enable-laypeople-to-perform-complex-medical",
      "title": "Italian Researchers Develop Augmented Reality Device That Could Potentially Enable Laypeople To Perform Complex Medical Procedures",
      "body": "![](https://cdn.steemitimages.com/DQmV9xZG3PVW3eAWRquhraqXJndypnjtYWmbsMNcDvp85Q5/image.png)\n\nIn the not so distant future, it’s entirely possible that human beings won’t need to carry any specialized knowledge around in their memory. Much like calculators have erased the need for on-the-fly mathematical calculations, augmented reality programs could replace domain-specific knowledge.\n\nWhile it’s still mostly theoretical at this point, augmented reality enthusiasts around the world are slowly integrating the medium’s unique benefits into their training programs. One team of Italian-based researchers have created augmented reality software that can project 3D models of CT scans directly onto a human body. So far, they’ve only applied this concept to needle insertion — generally a first step in interventional oncology — and found it to be successful within a 5 millimeter range.\n\n This may not sound too particularly exciting at first, but fast forward ten years into the future and the implications may be huge. Inserting a needle is a fairly simple task, even for something as complex as cancer surgery. But imagine a future where the entire surgical process was guided by augmented reality. Not only would costs of expensive medical procedures likely drop, but human beings in parts of the world without highly-trained surgeons would still be able to take emergency measures against aggressive cancer.\n\nFurthermore, removing the need for ultrasound and CT scans would protect technicians from overexposure to harmful radiation.\n\nMarco Solbiati, the creator of the software, explains the benefits of his system:\n\n    “Efforts have recently been made not only to improve the efficacy of ablative devices, but also to increase the accuracy of image-guiding systems. Several navigation systems have been developed using augmented reality techniques … [that] allow the operator to see 3D virtual objects superimposed upon the real world and not on a different screen.”\n\nCurrently, Solbiati and his team are working on more ways to make their prototype even better. Such changes include improving the 3D architecture of a patient’s internal organs and reducing the amount of skin markers necessary for aligning the device.\n\nOnce the device becomes accurate enough, then it’s only a matter of time before advanced medical procedures are no longer something that trained medical professionals who have spent 10 years in medical school are qualified to perform. When will that day come? Likely sooner than we think.",
      "json_metadata": "{\"tags\":[\"technology\",\"medicine\",\"interesting\",\"cool\",\"news\"],\"image\":[\"https://cdn.steemitimages.com/DQmV9xZG3PVW3eAWRquhraqXJndypnjtYWmbsMNcDvp85Q5/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/09/08 12:46:57
parent authorlucydico
parent permlinkmeet-the-merge-cube-an-augmented-reality-device-you-can-hold-in-hand
authorsteemitboard
permlinksteemitboard-notify-lucydico-20180908t124659000z
title
bodyCongratulations @lucydico! You have completed the following achievement on the Steem blockchain and have been rewarded with new badge(s) : [![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/posts.png)](http://steemitboard.com/@lucydico) Award for the number of posts published <sub>_Click on the badge to view your Board of Honor._</sub> <sub>_If you no longer want to receive notifications, reply to this comment with the word_ `STOP`</sub> **Do not miss the last post from @steemitboard:** <table><tr><td><a href="https://steemit.com/steemitboard/@steemitboard/steemitboard-witness-update-2018-09-07"><img src="https://steemitimages.com/64x128/http://i.cubeupload.com/7CiQEO.png"></a></td><td><a href="https://steemit.com/steemitboard/@steemitboard/steemitboard-witness-update-2018-09-07">SteemitBoard - Witness Update</a></td></tr><tr><td><a href="https://steemit.com/steemfest/@steemitboard/steemfest-steemitboard-support-the-travel-reimbursement-fund"><img src="https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmawPYDAwfrQM8YU6ejD1f87g64cvsmEFn8RQKHJMs4zxg/image.png"></a></td><td><a href="https://steemit.com/steemfest/@steemitboard/steemfest-steemitboard-support-the-travel-reimbursement-fund">SteemFest³ - SteemitBoard support the Travel Reimbursement Fund.</a></td></tr></table> > Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #25780307/Trx e7e3c431a6f67b98ac7ad6bb2521302fe17e24a1
View Raw JSON Data
{
  "trx_id": "e7e3c431a6f67b98ac7ad6bb2521302fe17e24a1",
  "block": 25780307,
  "trx_in_block": 76,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T12:46:57",
  "op": [
    "comment",
    {
      "parent_author": "lucydico",
      "parent_permlink": "meet-the-merge-cube-an-augmented-reality-device-you-can-hold-in-hand",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-lucydico-20180908t124659000z",
      "title": "",
      "body": "Congratulations @lucydico! You have completed the following achievement on the Steem blockchain and have been rewarded with new badge(s) :\n\n[![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/posts.png)](http://steemitboard.com/@lucydico) Award for the number of posts published\n\n<sub>_Click on the badge to view your Board of Honor._</sub>\n<sub>_If you no longer want to receive notifications, reply to this comment with the word_ `STOP`</sub>\n\n\n\n**Do not miss the last post from @steemitboard:**\n<table><tr><td><a href=\"https://steemit.com/steemitboard/@steemitboard/steemitboard-witness-update-2018-09-07\"><img src=\"https://steemitimages.com/64x128/http://i.cubeupload.com/7CiQEO.png\"></a></td><td><a href=\"https://steemit.com/steemitboard/@steemitboard/steemitboard-witness-update-2018-09-07\">SteemitBoard - Witness Update</a></td></tr><tr><td><a href=\"https://steemit.com/steemfest/@steemitboard/steemfest-steemitboard-support-the-travel-reimbursement-fund\"><img src=\"https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmawPYDAwfrQM8YU6ejD1f87g64cvsmEFn8RQKHJMs4zxg/image.png\"></a></td><td><a href=\"https://steemit.com/steemfest/@steemitboard/steemfest-steemitboard-support-the-travel-reimbursement-fund\">SteemFest³ - SteemitBoard support the Travel Reimbursement Fund.</a></td></tr></table>\n\n> Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2018/09/08 07:34:48
parent author
parent permlinktechnology
authorlucydico
permlinkmeet-the-merge-cube-an-augmented-reality-device-you-can-hold-in-hand
titleMeet the Merge Cube: An Augmented Reality Device You Can Hold in Hand
body![](https://cdn.steemitimages.com/DQmT8jBjkoq4VEbj9BSebaCLP9aiGSi2z6MEr3YkJa5DLZn/image.png) Most augmented reality software is really nothing more than a digital overlay placed on real world objects. So what makes Merge Cube different? Their technology puts augmented reality at your fingertips - literally. Merge Cube is a small, $15 device that is used as a template for augmented reality effects. Instead of the effects being seen on a wall or in thin air, they're overlayed onto the cube itself. Roughly the size of a Rubick's Cube, the Merge Cube offers stunning augmented reality graphics in a bite-sized package. Users can use it to explore the solar system or traverse an ancient castle. And instead of waving awkwardly at the air, they've been gifted with a piece of "hardware" that they can manipulate with their fingertips. Although it does seem a bit awkward to hold the Merge Cube in one hand and your smartphone in the other, once AR glasses become mainstream, this problem is likely to disappear. Users also report that playing with the cube itself is fun, intuitive, and requires very little app-specific knowledge. If you can point your phone at it, you can figure it out. Complete with a developer kit for 3rd parties to create apps on the platform, it seems that Merge Cube is aiming to be more than just a gimmicky toy. One only wonders what freedom they'd have to create new, dynamic apps if only it wasn't required to hold a smartphone in order use it properly. One thing that Merge Cube does well is integrate our sense of touch into the augmented reality experience. To date, apps like Pokemon Go and Snapchat have a more "virtual" feel. The effects are not felt, only seen. But with Merge Cube, users can "feel" the cube in their hands as well as see the effects, lending to a more complete visceral experience. Whether or not the Merge Cube will catch on is anyone's guess. But as experts in the field of augmented reality, we have to give them credit for their unique take on integrating the sense of touch into a medium where it is all but nonexistent. What do you think about Merge Cube? Let us know in a comment!
json metadata{"tags":["technology","news","interesting","cool","virtualreality"],"image":["https://cdn.steemitimages.com/DQmT8jBjkoq4VEbj9BSebaCLP9aiGSi2z6MEr3YkJa5DLZn/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25774068/Trx 1f1b7f499a3e61159588d88d46087579e7c9204c
View Raw JSON Data
{
  "trx_id": "1f1b7f499a3e61159588d88d46087579e7c9204c",
  "block": 25774068,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T07:34:48",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "technology",
      "author": "lucydico",
      "permlink": "meet-the-merge-cube-an-augmented-reality-device-you-can-hold-in-hand",
      "title": "Meet the Merge Cube: An Augmented Reality Device You Can Hold in Hand",
      "body": "![](https://cdn.steemitimages.com/DQmT8jBjkoq4VEbj9BSebaCLP9aiGSi2z6MEr3YkJa5DLZn/image.png)\n\nMost augmented reality software is really nothing more than a digital overlay placed on real world objects. So what makes Merge Cube different? Their technology puts augmented reality at your fingertips - literally.\n\nMerge Cube is a small, $15 device that is used as a template for augmented reality effects. Instead of the effects being seen on a wall or in thin air, they're overlayed onto the cube itself.\n\nRoughly the size of a Rubick's Cube, the Merge Cube offers stunning augmented reality graphics in a bite-sized package. Users can use it to explore the solar system or traverse an ancient castle. And instead of waving awkwardly at the air, they've been gifted with a piece of \"hardware\" that they can manipulate with their fingertips.\n\nAlthough it does seem a bit awkward to hold the Merge Cube in one hand and your smartphone in the other, once AR glasses become mainstream, this problem is likely to disappear. Users also report that playing with the cube itself is fun, intuitive, and requires very little app-specific knowledge. If you can point your phone at it, you can figure it out.\n\nComplete with a developer kit for 3rd parties to create apps on the platform, it seems that Merge Cube is aiming to be more than just a gimmicky toy. One only wonders what freedom they'd have to create new, dynamic apps if only it wasn't required to hold a smartphone in order use it properly.\n\nOne thing that Merge Cube does well is integrate our sense of touch into the augmented reality experience. To date, apps like Pokemon Go and Snapchat have a more \"virtual\" feel. The effects are not felt, only seen. But with Merge Cube, users can \"feel\" the cube in their hands as well as see the effects, lending to a more complete visceral experience.\n\nWhether or not the Merge Cube will catch on is anyone's guess. But as experts in the field of augmented reality, we have to give them credit for their unique take on integrating the sense of touch into a medium where it is all but nonexistent.\n\nWhat do you think about Merge Cube? Let us know in a comment!",
      "json_metadata": "{\"tags\":[\"technology\",\"news\",\"interesting\",\"cool\",\"virtualreality\"],\"image\":[\"https://cdn.steemitimages.com/DQmT8jBjkoq4VEbj9BSebaCLP9aiGSi2z6MEr3YkJa5DLZn/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/09/08 07:27:36
parent author
parent permlinklucyd
authorlucydico
permlinkgerman-newspaper-brings-life-to-print-news-a-la-harry-potter
titleGerman Newspaper Brings Life To Print News A La Harry Potter
body![](https://cdn.steemitimages.com/DQmZ56kjrzXSExnuAWwgiiUFW3SFqtwyUsYKFRZ7zQnySxK/image.png) In the Harry Potter movies, the newspapers are animated. Instead of simply standing still, pictures of individuals come to live with facial expressions and movement. You could say that JK Rowling was pioneering augmented reality without even knowing it. A newspaper in Europe has done the same thing. The biggest selling daily European newspaper, Bild, now has a feature that will transform pictures in the paper into thirty second video clips when users hover with their smartphones. Currently, the only supported news items are stories from Germany’s recent soccer matches in the Bundesliga season. And while this isn’t the first attempt to integrate augmented reality and print news (JK Rowling would have to take credit for that), it’s certainly the largest scale effort. Japan and Canada have also played around with combining newspapers and augmented reality, but their efforts have been sporadic at best. Introduced only as an advertising gimmick as opposed to a feature of the paper, they have failed to adopt the unique stance that Bild has: offering content exclusively via augmented reality medium. These video clips are available only via the newspaper — so either readers take advantage of it, or they go without. Perhaps best of all is that this feature is available at no extra cost. It’s simply an additional perk of buying the paper. Most interesting is the fact that while many newspapers are slowly dissolving their print assets in favor of digital ones, Bild seems to be taking a different approach. Instead of ditching their old-fashioned paper newspaper, they’re incentivizing users to purchase it with exclusive content. A creative marketing strategy? Perhaps. Bild’s sales have dropped by over 50% in the past 15 years to “only” 1.7 million copies a day in 2017. Will augmented reality save their shrinking newspaper? And by extension, will it save other hurting companies in the publishing industry? Only time will tell. What do you think about Bild’s augmented reality features? Let us know in a comment!
json metadata{"tags":["lucyd","augmentedreality","virtualreality","tech","news"],"image":["https://cdn.steemitimages.com/DQmZ56kjrzXSExnuAWwgiiUFW3SFqtwyUsYKFRZ7zQnySxK/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25773924/Trx 623a5bbf6ef85797863e6cfde9f8ffd7f1c58962
View Raw JSON Data
{
  "trx_id": "623a5bbf6ef85797863e6cfde9f8ffd7f1c58962",
  "block": 25773924,
  "trx_in_block": 9,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-08T07:27:36",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "lucyd",
      "author": "lucydico",
      "permlink": "german-newspaper-brings-life-to-print-news-a-la-harry-potter",
      "title": "German Newspaper Brings Life To Print News A La Harry Potter",
      "body": "![](https://cdn.steemitimages.com/DQmZ56kjrzXSExnuAWwgiiUFW3SFqtwyUsYKFRZ7zQnySxK/image.png)\n\nIn the Harry Potter movies, the newspapers are animated. Instead of simply standing still, pictures of individuals come to live with facial expressions and movement. You could say that JK Rowling was pioneering augmented reality without even knowing it.\n\nA newspaper in Europe has done the same thing. The biggest selling daily European newspaper, Bild, now has a feature that will transform pictures in the paper into thirty second video clips when users hover with their smartphones.\n\nCurrently, the only supported news items are stories from Germany’s recent soccer matches in the Bundesliga season. And while this isn’t the first attempt to integrate augmented reality and print news (JK Rowling would have to take credit for that), it’s certainly the largest scale effort.\n\nJapan and Canada have also played around with combining newspapers and augmented reality, but their efforts have been sporadic at best. Introduced only as an advertising gimmick as opposed to a feature of the paper, they have failed to adopt the unique stance that Bild has: offering content exclusively via augmented reality medium. These video clips are available only via the newspaper — so either readers take advantage of it, or they go without.\n\nPerhaps best of all is that this feature is available at no extra cost. It’s simply an additional perk of buying the paper.\n\nMost interesting is the fact that while many newspapers are slowly dissolving their print assets in favor of digital ones, Bild seems to be taking a different approach. Instead of ditching their old-fashioned paper newspaper, they’re incentivizing users to purchase it with exclusive content. A creative marketing strategy? Perhaps.\n\nBild’s sales have dropped by over 50% in the past 15 years to “only” 1.7 million copies a day in 2017. Will augmented reality save their shrinking newspaper? And by extension, will it save other hurting companies in the publishing industry? Only time will tell.\n\nWhat do you think about Bild’s augmented reality features? Let us know in a comment!",
      "json_metadata": "{\"tags\":[\"lucyd\",\"augmentedreality\",\"virtualreality\",\"tech\",\"news\"],\"image\":[\"https://cdn.steemitimages.com/DQmZ56kjrzXSExnuAWwgiiUFW3SFqtwyUsYKFRZ7zQnySxK/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
lucydicoreceived 3.698 STEEM from power down installment (4.594 SP)
2018/09/05 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.698 STEEM
Transaction InfoBlock #25694500/Virtual Operation #11
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 25694500,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 11,
  "timestamp": "2018-09-05T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.698 STEEM"
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new frie..."
2018/09/04 13:58:21
frommerlin7
tolucydico
amount0.001 SBD
memo=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 51,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers above reputation 60 prefer this service** Merlin7 ranks** 96** in TOP CURATORS OF STEEMIT..https://steemit.com/bisteemit/@boddhisattva/top-200-effective-steemit-curators-who-are-actively-support-newcomers-with-reputation-below-55-for-the-last-week-2018-08-20-2018
Transaction InfoBlock #25666592/Trx 6969d2a59edb7bfac84a8a92b992832b7621d994
View Raw JSON Data
{
  "trx_id": "6969d2a59edb7bfac84a8a92b992832b7621d994",
  "block": 25666592,
  "trx_in_block": 44,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-04T13:58:21",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 51,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers  above reputation 60 prefer this service** Merlin7 ranks** 96** in TOP CURATORS OF STEEMIT..https://steemit.com/bisteemit/@boddhisattva/top-200-effective-steemit-curators-who-are-actively-support-newcomers-with-reputation-below-55-for-the-last-week-2018-08-20-2018"
    }
  ]
}
abcorsent 0.001 STEEM to @lucydico- "📌"Best Curation Service" Send 3 SBD/Steem and you will get 100+ votes in your next 10 posts + resteem to my 8500+ followes or send 8 SBD/Steem for 30 posts."
2018/09/01 14:44:15
fromabcor
tolucydico
amount0.001 STEEM
memo📌"Best Curation Service" Send 3 SBD/Steem and you will get 100+ votes in your next 10 posts + resteem to my 8500+ followes or send 8 SBD/Steem for 30 posts.
Transaction InfoBlock #25581179/Trx eaa4c4a6c770971e5c18ebc555f3b1b99ca5161f
View Raw JSON Data
{
  "trx_id": "eaa4c4a6c770971e5c18ebc555f3b1b99ca5161f",
  "block": 25581179,
  "trx_in_block": 48,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-01T14:44:15",
  "op": [
    "transfer",
    {
      "from": "abcor",
      "to": "lucydico",
      "amount": "0.001 STEEM",
      "memo": "📌\"Best Curation Service\" Send 3 SBD/Steem and you will get 100+ votes in your next 10 posts + resteem to my 8500+ followes or send 8 SBD/Steem for 30 posts."
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new frie..."
2018/09/01 06:09:03
frommerlin7
tolucydico
amount0.001 SBD
memo=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers above reputation 60 prefer this service** Ranked 114** in top curators in Steemit. Check for yourself.. https://steemit.com/bisteemit/@boddhistats/steem-top-200-effective-steemit-curators-in-steem-category-for-the-last-week-2018-08-20-2018-08-26
Transaction InfoBlock #25570877/Trx 7e4dd52514f2e44f5745918573f017fc7929dcef
View Raw JSON Data
{
  "trx_id": "7e4dd52514f2e44f5745918573f017fc7929dcef",
  "block": 25570877,
  "trx_in_block": 53,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-01T06:09:03",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers  above reputation 60 prefer this service** Ranked 114** in top curators in Steemit. Check for yourself.. https://steemit.com/bisteemit/@boddhistats/steem-top-200-effective-steemit-curators-in-steem-category-for-the-last-week-2018-08-20-2018-08-26"
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new frie..."
2018/09/01 05:55:03
frommerlin7
tolucydico
amount0.001 SBD
memo=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers above reputation 60 prefer this service** Ranked 114** in top curators in Steemit. Check for yourself.. https://steemit.com/bisteemit/@boddhistats/steem-top-200-effective-steemit-curators-in-steem-category-for-the-last-week-2018-08-20-2018-08-26
Transaction InfoBlock #25570597/Trx dbe28c461852600c7be85f5d53fe47a5fdcdfb55
View Raw JSON Data
{
  "trx_id": "dbe28c461852600c7be85f5d53fe47a5fdcdfb55",
  "block": 25570597,
  "trx_in_block": 36,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-01T05:55:03",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers  above reputation 60 prefer this service** Ranked 114** in top curators in Steemit. Check for yourself.. https://steemit.com/bisteemit/@boddhistats/steem-top-200-effective-steemit-curators-in-steem-category-for-the-last-week-2018-08-20-2018-08-26"
    }
  ]
}
2018/08/31 15:10:30
parent author
parent permlinktechnology
authorlucydico
permlinkthis-utility-company-has-developed-an-augmented-reality-solution-to-its-complex-technical-problems
titleThis Utility Company Has Developed An Augmented Reality Solution To Its Complex Technical Problems
body![](https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png) Imagine a future where technical jobs require minimal education. Instead of technicians needing to know what every transistor and dial does in a piece of machinery, they simply point their smartphone camera at an exposed wiring panel. A digital overlay pops up, tells the tech what needs to be adjusted and why, and the problem is solved. That’s exactly what one utility company, Westar Energy, is building into its infrastructure. When one hears the term, “augmented reality,” it’s not likely that utility companies are the first thing that come to mind. But if there’s one thing companies love, it’s cutting costs. And any time human knowledge and experience can be replaced by software, that’s a massive opportunity for reducing overhead. The application, modestly dubbed the LineAssist SuperApp, is being rolled out to field technicians. It works by walking a tech through a troubleshooter for each specific model of controller. By using augmented reality, it shows the tech exactly what needs to be done to solve a given problem, much like the example above. Not only that, but the app includes reference material for the craftsman to use in case there is a related problem that isn’t explicitly covered by the app itself. While it’s reasonable to expect that it may take some months for all the bugs to be worked out of the program, Westar Energy is likely expecting this push into augmented reality to be well worth the investment. Taking technicians away from their work to drive to a site and work on something complex like a line voltage regulator is time consuming and expensive. If the app manages to cut the frequency with which techs need to drive out and work on the problem themselves, then the program will have paid for itself and then some over the long term. What do you think about Westar Energy’s foray into the augmented reality world? Let us know in a comment!
json metadata{"tags":["technology","energy","business","news","interesting"],"image":["https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25552913/Trx a8713812ab137a413c55ab55a512a4dcaf217bf9
View Raw JSON Data
{
  "trx_id": "a8713812ab137a413c55ab55a512a4dcaf217bf9",
  "block": 25552913,
  "trx_in_block": 28,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-31T15:10:30",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "technology",
      "author": "lucydico",
      "permlink": "this-utility-company-has-developed-an-augmented-reality-solution-to-its-complex-technical-problems",
      "title": "This Utility Company Has Developed An Augmented Reality Solution To Its Complex Technical Problems",
      "body": "![](https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png)\n\nImagine a future where technical jobs require minimal education. Instead of technicians needing to know what every transistor and dial does in a piece of machinery, they simply point their smartphone camera at an exposed wiring panel. A digital overlay pops up, tells the tech what needs to be adjusted and why, and the problem is solved.\n\nThat’s exactly what one utility company, Westar Energy, is building into its infrastructure.\n\nWhen one hears the term, “augmented reality,” it’s not likely that utility companies are the first thing that come to mind. But if there’s one thing companies love, it’s cutting costs. And any time human knowledge and experience can be replaced by software, that’s a massive opportunity for reducing overhead.\n\nThe application, modestly dubbed the LineAssist SuperApp, is being rolled out to field technicians. It works by walking a tech through a troubleshooter for each specific model of controller. By using augmented reality, it shows the tech exactly what needs to be done to solve a given problem, much like the example above.\n\nNot only that, but the app includes reference material for the craftsman to use in case there is a related problem that isn’t explicitly covered by the app itself.\n\nWhile it’s reasonable to expect that it may take some months for all the bugs to be worked out of the program, Westar Energy is likely expecting this push into augmented reality to be well worth the investment. Taking technicians away from their work to drive to a site and work on something complex like a line voltage regulator is time consuming and expensive. If the app manages to cut the frequency with which techs need to drive out and work on the problem themselves, then the program will have paid for itself and then some over the long term.\n\nWhat do you think about Westar Energy’s foray into the augmented reality world? Let us know in a comment!",
      "json_metadata": "{\"tags\":[\"technology\",\"energy\",\"business\",\"news\",\"interesting\"],\"image\":[\"https://cdn.steemitimages.com/DQmXmA9zGzp7fhrhAa1LBQ1TAYRRQ3e25PnTHpqTBf7JSQ1/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- " =>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new fri..."
2018/08/31 09:06:15
frommerlin7
tolucydico
amount0.001 SBD
memo =>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY! MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers above reputation 60 prefer this service** Ranked 114** in top curators in Steemit. Check for yourself.. https://steemit.com/bisteemit/@boddhistats/steem-top-200-effective-steemit-curators-in-steem-category-for-the-last-week-2018-08-20-2018-08-26
Transaction InfoBlock #25545629/Trx 58f1449bf55dba04c0dc64ad70adee71bab4aa7b
View Raw JSON Data
{
  "trx_id": "58f1449bf55dba04c0dc64ad70adee71bab4aa7b",
  "block": 25545629,
  "trx_in_block": 20,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-31T09:06:15",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": " =>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3500 active followers, send 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶HURRY!  MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│More than 30 customers  above reputation 60 prefer this service** Ranked 114** in top curators in Steemit. Check for yourself.. https://steemit.com/bisteemit/@boddhistats/steem-top-200-effective-steemit-curators-in-steem-category-for-the-last-week-2018-08-20-2018-08-26"
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- " =>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 active followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to ..."
2018/08/30 07:25:21
frommerlin7
tolucydico
amount0.001 SBD
memo =>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 active followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│
Transaction InfoBlock #25514823/Trx 362d937c049263b0faaa6708348e99c9fb8310b9
View Raw JSON Data
{
  "trx_id": "362d937c049263b0faaa6708348e99c9fb8310b9",
  "block": 25514823,
  "trx_in_block": 55,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-30T07:25:21",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": " =>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 active followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│"
    }
  ]
}
lucydicoreceived 3.696 STEEM from power down installment (4.594 SP)
2018/08/29 13:14:48
from accountlucydico
to accountlucydico
withdrawn7480.995371 VESTS
deposited3.696 STEEM
Transaction InfoBlock #25493033/Virtual Operation #33
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 25493033,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 33,
  "timestamp": "2018-08-29T13:14:48",
  "op": [
    "fill_vesting_withdraw",
    {
      "from_account": "lucydico",
      "to_account": "lucydico",
      "withdrawn": "7480.995371 VESTS",
      "deposited": "3.696 STEEM"
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 ‘ACTIVE’ followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account t..."
2018/08/29 06:33:09
frommerlin7
tolucydico
amount0.001 SBD
memo=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 ‘ACTIVE’ followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│
Transaction InfoBlock #25485004/Trx dba895f959f2b0b67ee1d170601fcb91f8b74bdc
View Raw JSON Data
{
  "trx_id": "dba895f959f2b0b67ee1d170601fcb91f8b74bdc",
  "block": 25485004,
  "trx_in_block": 65,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-29T06:33:09",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 ‘ACTIVE’  followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│"
    }
  ]
}
2018/08/27 15:04:06
voteryehey
authorlucydico
permlinksmithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens
weight1000 (10.00%)
Transaction InfoBlock #25437655/Trx 17e521e950fbb4b05dd16db5b4b340f83cf0b110
View Raw JSON Data
{
  "trx_id": "17e521e950fbb4b05dd16db5b4b340f83cf0b110",
  "block": 25437655,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-27T15:04:06",
  "op": [
    "vote",
    {
      "voter": "yehey",
      "author": "lucydico",
      "permlink": "smithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens",
      "weight": 1000
    }
  ]
}
2018/08/27 15:02:39
voteracknowledgement
authorlucydico
permlinksmithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens
weight1000 (10.00%)
Transaction InfoBlock #25437626/Trx fd9c356f531ec89334737dcd6bc63af98e067ee1
View Raw JSON Data
{
  "trx_id": "fd9c356f531ec89334737dcd6bc63af98e067ee1",
  "block": 25437626,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-27T15:02:39",
  "op": [
    "vote",
    {
      "voter": "acknowledgement",
      "author": "lucydico",
      "permlink": "smithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens",
      "weight": 1000
    }
  ]
}
2018/08/27 14:41:42
votersmartmedia-group
authorlucydico
permlinksmithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens
weight1000 (10.00%)
Transaction InfoBlock #25437207/Trx 8e48048d16f5017c51b9a59a7a3c9705948dec22
View Raw JSON Data
{
  "trx_id": "8e48048d16f5017c51b9a59a7a3c9705948dec22",
  "block": 25437207,
  "trx_in_block": 25,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-27T14:41:42",
  "op": [
    "vote",
    {
      "voter": "smartmedia-group",
      "author": "lucydico",
      "permlink": "smithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens",
      "weight": 1000
    }
  ]
}
2018/08/27 14:27:39
voterjigsjavi
authorlucydico
permlinksmithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens
weight10000 (100.00%)
Transaction InfoBlock #25436926/Trx 4625ac2a44be3a6b5477d78c6dd59bba300041ab
View Raw JSON Data
{
  "trx_id": "4625ac2a44be3a6b5477d78c6dd59bba300041ab",
  "block": 25436926,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-27T14:27:39",
  "op": [
    "vote",
    {
      "voter": "jigsjavi",
      "author": "lucydico",
      "permlink": "smithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens",
      "weight": 10000
    }
  ]
}
2018/08/27 14:23:06
parent author
parent permlinkvirtualreality
authorlucydico
permlinksmithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens
titleSmithsonian Museum Lets Users Experience Burning Man Exhibit Through Custom Snapchat Lens
body<center>![](https://cdn.steemitimages.com/DQmRstXQDC8yvu55akdL7vpx3ApQ9wGzUzB6GUXPjMzhMae/image.png) Credit: Reno Gazette</center> Every year, tens of thousands of people get together in the Nevada desert, erect a fake city where money is not allowed, and live for a week and a half as if the world had experienced a nuclear apocalypse. The event? Burning Man.  While just over 50,000 people are expected to attend the event, the Smithsonian Museum is looking to make the event accessible to the rest of the world. Their Burning Man exhibit, No Spectators: The Art of Burning Man, utilizes an augmented reality Snapchat Lens to allow users to "walk through" the Renwick Gallery where the exhibit is located. Ilana Rosin, Associate Director of Paid Social Media, said this about the exhibit: > "It looks a little funny when you see people holding up their phone and staring at their screen. But what they're actually doing is viewing the art, reading about the artists that created them, and moving around the room." Sponsored by technology giant Intel, this project allegedly started as a way for the Smithsonian to digitize its millions of timeless artifacts "just in case." But now, the project has expanded into creating mixed reality experiences to over one billion people worldwide.  To take things one step further, Intel has also announced a partnership with Sansar, a virtual reality social network lead by the founders of the now-defunct social network Second Life. In Q4 2018, users will be able to don a virtual reality headset and "follow" VR museum curators for a tour - just like they were in the Smithsonian. From Snapchat's perspective, this appears to ironically be a way for the company to stay relevant. As Instagram continues to steal market share from their little brother, Snapchat finds its daily user base shrinking while Instagram's grows. While this is encouraging rapid development from the Venice Beach startup, it remains to be seen whether or not it will be the feature that returns Snapchat to its 2016 glory. What do you think about the Smithsonian's Burning Man project? Let us know in a comment! # IMPORTANT NEWS: Lucyd Mini-update Aug 24th Hello Lucyd community! Thanks for your interest and support. We have a lot of exciting developments in the works for 2018 and beyond. ![](https://cdn.steemitimages.com/DQmTpNgxxm2v32Xmnr6mqykbHgEV7tmEhpYkrpFgD9J3weX/image.png) Hey everyone, we want our community to try the Lucyd.co eShop. Use code 3RDEYE for 15% off, and leave your feedback at [email protected]. We're actively working on adding a virtual try-on app, smoothing the overall experience, adding an eye health and eyewear info center, as well as LCD integration for rewards. We are also beginning development on several apps for LCD and for wearables. In the meantime, did you know you can store LCD easily in the coinpayments.net wallet? Don't have any LCD? Scoop some on the low from idex.market/eth/lcd. Just browsing helps too, your feedback will help us make a better experience. Our community has proved invaluable in shaping of Lucyd, your voice will be heard! We are an eyewear company funded by the people, for the people. That's all for now! Stay tuned for more updates, and upgrade your eyewear now at lucyd.co!
json metadata{"tags":["virtualreality","news","cool","weird","interesting"],"image":["https://cdn.steemitimages.com/DQmRstXQDC8yvu55akdL7vpx3ApQ9wGzUzB6GUXPjMzhMae/image.png","https://cdn.steemitimages.com/DQmTpNgxxm2v32Xmnr6mqykbHgEV7tmEhpYkrpFgD9J3weX/image.png"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25436835/Trx 71ad7c45706a98ee589f6aa3eaf4593fbae57b1d
View Raw JSON Data
{
  "trx_id": "71ad7c45706a98ee589f6aa3eaf4593fbae57b1d",
  "block": 25436835,
  "trx_in_block": 15,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-27T14:23:06",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "virtualreality",
      "author": "lucydico",
      "permlink": "smithsonian-museum-lets-users-experience-burning-man-exhibit-through-custom-snapchat-lens",
      "title": "Smithsonian Museum Lets Users Experience Burning Man Exhibit Through Custom Snapchat Lens",
      "body": "<center>![](https://cdn.steemitimages.com/DQmRstXQDC8yvu55akdL7vpx3ApQ9wGzUzB6GUXPjMzhMae/image.png)\nCredit: Reno Gazette</center>\n\nEvery year, tens of thousands of people get together in the Nevada desert, erect a fake city where money is not allowed, and live for a week and a half as if the world had experienced a nuclear apocalypse. The event? Burning Man. \n\nWhile just over 50,000 people are expected to attend the event, the Smithsonian Museum is looking to make the event accessible to the rest of the world. Their Burning Man exhibit, No Spectators: The Art of Burning Man, utilizes an augmented reality Snapchat Lens to allow users to \"walk through\" the Renwick Gallery where the exhibit is located.\n\nIlana Rosin, Associate Director of Paid Social Media, said this about the exhibit:\n\n> \"It looks a little funny when you see people holding up their phone and staring at their screen. But what they're actually doing is viewing the art, reading about the artists that created them, and moving around the room.\"\n\nSponsored by technology giant Intel, this project allegedly started as a way for the Smithsonian to digitize its millions of timeless artifacts \"just in case.\" But now, the project has expanded into creating mixed reality experiences to over one billion people worldwide. \n\nTo take things one step further, Intel has also announced a partnership with Sansar, a virtual reality social network lead by the founders of the now-defunct social network Second Life. In Q4 2018, users will be able to don a virtual reality headset and \"follow\" VR museum curators for a tour - just like they were in the Smithsonian.\n\nFrom Snapchat's perspective, this appears to ironically be a way for the company to stay relevant. As Instagram continues to steal market share from their little brother, Snapchat finds its daily user base shrinking while Instagram's grows. While this is encouraging rapid development from the Venice Beach startup, it remains to be seen whether or not it will be the feature that returns Snapchat to its 2016 glory.\n\nWhat do you think about the Smithsonian's Burning Man project? Let us know in a comment!\n\n# IMPORTANT NEWS: Lucyd Mini-update Aug 24th\n\nHello Lucyd community! Thanks for your interest and support. We have a lot of exciting developments in the works for 2018 and beyond.\n\n![](https://cdn.steemitimages.com/DQmTpNgxxm2v32Xmnr6mqykbHgEV7tmEhpYkrpFgD9J3weX/image.png)\n\nHey everyone, we want our community to try the Lucyd.co eShop. Use code 3RDEYE for 15% off, and leave your feedback at [email protected].\nWe're actively working on adding a virtual try-on app, smoothing the overall experience, adding an eye health and eyewear info center, as well as LCD integration for rewards. We are also beginning development on several apps for LCD and for wearables. In the meantime, did you know you can store LCD easily in the coinpayments.net wallet? Don't have any LCD? Scoop some on the low from idex.market/eth/lcd.\nJust browsing helps too, your feedback will help us make a better experience. Our community has proved invaluable in shaping of Lucyd, your voice will be heard! We are an eyewear company funded by the people, for the people.\nThat's all for now! Stay tuned for more updates, and upgrade your eyewear now at lucyd.co!",
      "json_metadata": "{\"tags\":[\"virtualreality\",\"news\",\"cool\",\"weird\",\"interesting\"],\"image\":[\"https://cdn.steemitimages.com/DQmRstXQDC8yvu55akdL7vpx3ApQ9wGzUzB6GUXPjMzhMae/image.png\",\"https://cdn.steemitimages.com/DQmTpNgxxm2v32Xmnr6mqykbHgEV7tmEhpYkrpFgD9J3weX/image.png\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/08/27 12:54:03
authorlucydico
permlinkaugmented-reality-menus-finding-their-way-into-establishments-in-new-york-city
sbd payout0.000 SBD
steem payout0.014 STEEM
vesting payout30.358086 VESTS
Transaction InfoBlock #25435053/Virtual Operation #4
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 25435053,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 4,
  "timestamp": "2018-08-27T12:54:03",
  "op": [
    "author_reward",
    {
      "author": "lucydico",
      "permlink": "augmented-reality-menus-finding-their-way-into-establishments-in-new-york-city",
      "sbd_payout": "0.000 SBD",
      "steem_payout": "0.014 STEEM",
      "vesting_payout": "30.358086 VESTS"
    }
  ]
}
2018/08/26 12:34:42
voterkhudgabbar
authorlucydico
permlinklucyd-eshop-grand-opening
weight10000 (100.00%)
Transaction InfoBlock #25405869/Trx 578f8637126f63feb5de3c2b1527c95254797bbd
View Raw JSON Data
{
  "trx_id": "578f8637126f63feb5de3c2b1527c95254797bbd",
  "block": 25405869,
  "trx_in_block": 26,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-26T12:34:42",
  "op": [
    "vote",
    {
      "voter": "khudgabbar",
      "author": "lucydico",
      "permlink": "lucyd-eshop-grand-opening",
      "weight": 10000
    }
  ]
}
merlin7sent 0.001 SBD to @lucydico- "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 active followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to s..."
2018/08/26 11:22:33
frommerlin7
tolucydico
amount0.001 SBD
memo=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 active followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│
Transaction InfoBlock #25404426/Trx 11bf29f7eebabd9c2e0877063cb67a7c4908fbba
View Raw JSON Data
{
  "trx_id": "11bf29f7eebabd9c2e0877063cb67a7c4908fbba",
  "block": 25404426,
  "trx_in_block": 66,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-26T11:22:33",
  "op": [
    "transfer",
    {
      "from": "merlin7",
      "to": "lucydico",
      "amount": "0.001 SBD",
      "memo": "=>Grow Fast in less time, promote your post with nearly 55,000 Following+ 3000 active followers, send 0.5SBD / 0.6STEEM to 1SBD/1.5STEEM to 2SBD/2.5STEEM to 2.5SBD/3STEEM.. Invest in your account to succeed! Find new friends/voters who will vote your posts daily. Put posts url in memo and @merlin7 ( 47,800 SP) will resteem your post + 100% upvote. Min 60+ accounts upvote from active followers.◀◀ +LOYALTY BONUS FREE EVERYDAY+ NEW *ACTIVE*FOLLOWERS + ▶▶ 2 SBD PRIZE MONEY FOR HIGHEST USER EVERY WEEK◀◀│ ▶▶MONTHLY LOTTERY OF 5 SBD TO 3 INDIVIDUAL │ ◀◀Subscribe weekly service with 10 STEEM ◀◀│"
    }
  ]
}
2018/08/23 16:24:30
voterharrison40
authorlucydico
permlinkat-the-center-of-the-ar-revolution-the-selfie
weight10000 (100.00%)
Transaction InfoBlock #25324123/Trx fd69e5ed87050e468496cc5befa4d84bbd188b3d
View Raw JSON Data
{
  "trx_id": "fd69e5ed87050e468496cc5befa4d84bbd188b3d",
  "block": 25324123,
  "trx_in_block": 22,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-23T16:24:30",
  "op": [
    "vote",
    {
      "voter": "harrison40",
      "author": "lucydico",
      "permlink": "at-the-center-of-the-ar-revolution-the-selfie",
      "weight": 10000
    }
  ]
}
2018/08/23 13:59:42
voterlakhan47
authorlucydico
permlinkat-the-center-of-the-ar-revolution-the-selfie
weight0 (0.00%)
Transaction InfoBlock #25321230/Trx bc1bd355a02575acd7b3b2ff736736a30ccb1cc9
View Raw JSON Data
{
  "trx_id": "bc1bd355a02575acd7b3b2ff736736a30ccb1cc9",
  "block": 25321230,
  "trx_in_block": 30,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-23T13:59:42",
  "op": [
    "vote",
    {
      "voter": "lakhan47",
      "author": "lucydico",
      "permlink": "at-the-center-of-the-ar-revolution-the-selfie",
      "weight": 0
    }
  ]
}
2018/08/23 13:59:09
voterlakhan47
authorlucydico
permlinkat-the-center-of-the-ar-revolution-the-selfie
weight10000 (100.00%)
Transaction InfoBlock #25321219/Trx 1cefd597d8348575a9043660b39c53c2a719b124
View Raw JSON Data
{
  "trx_id": "1cefd597d8348575a9043660b39c53c2a719b124",
  "block": 25321219,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-23T13:59:09",
  "op": [
    "vote",
    {
      "voter": "lakhan47",
      "author": "lucydico",
      "permlink": "at-the-center-of-the-ar-revolution-the-selfie",
      "weight": 10000
    }
  ]
}
2018/08/23 13:58:48
parent author
parent permlinksocialmedia
authorlucydico
permlinkat-the-center-of-the-ar-revolution-the-selfie
titleAt the Center of the AR Revolution…the Selfie?
bodySelfies are undoubtedly driving innovation in AR, and have almost become a new American pastime. Read the full article on the [Lucyd blog,](https://cdn.lucyd.co/the-selfie-bringing-ar-mainstream/) or just check out the infographic here. ![](https://cdn.steemitimages.com/DQmTQMEztAJWzXUgoTr6KaVwcR5Qj6aN3TkoXB9ufsaRmC8/image.png)
json metadata{"tags":["socialmedia","instagram","selfie","life","fun"],"image":["https://cdn.steemitimages.com/DQmTQMEztAJWzXUgoTr6KaVwcR5Qj6aN3TkoXB9ufsaRmC8/image.png"],"links":["https://cdn.lucyd.co/the-selfie-bringing-ar-mainstream/"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #25321212/Trx f5e88242e154edd902de08c6f31550e665b6fb3b
View Raw JSON Data
{
  "trx_id": "f5e88242e154edd902de08c6f31550e665b6fb3b",
  "block": 25321212,
  "trx_in_block": 33,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-23T13:58:48",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "socialmedia",
      "author": "lucydico",
      "permlink": "at-the-center-of-the-ar-revolution-the-selfie",
      "title": "At the Center of the AR Revolution…the Selfie?",
      "body": "Selfies are undoubtedly driving innovation in AR, and have almost become a new American pastime. Read the full article on the [Lucyd blog,](https://cdn.lucyd.co/the-selfie-bringing-ar-mainstream/) or just check out the infographic here.\n\n![](https://cdn.steemitimages.com/DQmTQMEztAJWzXUgoTr6KaVwcR5Qj6aN3TkoXB9ufsaRmC8/image.png)",
      "json_metadata": "{\"tags\":[\"socialmedia\",\"instagram\",\"selfie\",\"life\",\"fun\"],\"image\":[\"https://cdn.steemitimages.com/DQmTQMEztAJWzXUgoTr6KaVwcR5Qj6aN3TkoXB9ufsaRmC8/image.png\"],\"links\":[\"https://cdn.lucyd.co/the-selfie-bringing-ar-mainstream/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}

Account Metadata

POSTING JSON METADATA
profile{"profile_image":"https://tokenmarket.net/blockchain-static/ethereum/assets/lucyd/logo_big.png","name":"Lucyd","about":"Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.","website":"https://lucyd.co"}
JSON METADATA
profile{"profile_image":"https://tokenmarket.net/blockchain-static/ethereum/assets/lucyd/logo_big.png","name":"Lucyd","about":"Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.","website":"https://lucyd.co"}
{
  "posting_json_metadata": {
    "profile": {
      "profile_image": "https://tokenmarket.net/blockchain-static/ethereum/assets/lucyd/logo_big.png",
      "name": "Lucyd",
      "about": "Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.",
      "website": "https://lucyd.co"
    }
  },
  "json_metadata": {
    "profile": {
      "profile_image": "https://tokenmarket.net/blockchain-static/ethereum/assets/lucyd/logo_big.png",
      "name": "Lucyd",
      "about": "Lucyd is a new augmented reality company based in Singapore. We are developing smartglasses, AR blockchain apps, and an eShop for cutting-edge eyewear.",
      "website": "https://lucyd.co"
    }
  }
}

Auth Keys

Owner
Single Signature
Public Keys
STM5zjvKf9ddzA71w3g7orWcjxk5y6rm2ozpkyrNWwEt5G5HgtJJF1/1
Active
Single Signature
Public Keys
STM86LZXgrAXvDLoSU7xrnJ7pbSAFyM144QBbT684FiHPiUq4CCcn1/1
Posting
Single Signature
Public Keys
STM5YVhvNVT1i8aQtQc7eEFcoxvygYpsTSVYGBTVJVAqrLimwUAwo1/1
App Permissions
Memo
STM5h8khPmvR3FR4ou6r3FqnPWZqUpzDZbJdYJaDYg2fXJ3NA7QwY
{
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM5zjvKf9ddzA71w3g7orWcjxk5y6rm2ozpkyrNWwEt5G5HgtJJF",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM86LZXgrAXvDLoSU7xrnJ7pbSAFyM144QBbT684FiHPiUq4CCcn",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [
      [
        "steemauto",
        1
      ]
    ],
    "key_auths": [
      [
        "STM5YVhvNVT1i8aQtQc7eEFcoxvygYpsTSVYGBTVJVAqrLimwUAwo",
        1
      ]
    ]
  },
  "memo": "STM5h8khPmvR3FR4ou6r3FqnPWZqUpzDZbJdYJaDYg2fXJ3NA7QwY"
}

Witness Votes

0 / 30
No active witness votes.
[]