Ecoer Logo
VOTING POWER100.00%
DOWNVOTE POWER100.00%
RESOURCE CREDITS100.00%
REPUTATION PROGRESS86.44%
Net Worth
3.989USD
STEEM
0.002STEEM
SBD
0.795SBD
Own SP
66.521SP

Detailed Balance

STEEM
balance
0.002STEEM
market_balance
0.000STEEM
savings_balance
0.000STEEM
reward_steem_balance
0.000STEEM
STEEM POWER
Own SP
66.521SP
Delegated Out
0.000SP
Delegation In
0.000SP
Effective Power
66.521SP
Reward SP (pending)
0.067SP
SBD
sbd_balance
0.000SBD
sbd_conversions
0.000SBD
sbd_market_balance
0.000SBD
savings_sbd_balance
0.751SBD
reward_sbd_balance
0.044SBD
{
  "balance": "0.002 STEEM",
  "savings_balance": "0.000 STEEM",
  "reward_steem_balance": "0.000 STEEM",
  "vesting_shares": "108323.292994 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "0.000000 VESTS",
  "sbd_balance": "0.000 SBD",
  "savings_sbd_balance": "0.751 SBD",
  "reward_sbd_balance": "0.044 SBD",
  "conversions": []
}

Account Info

namegurureviewer
id115508
rank27,218
reputation-801587079788
created2016-12-04T06:23:36
recovery_accountsteem
proxyNone
post_count411
comment_count0
lifetime_vote_count0
witnesses_voted_for0
last_post2018-05-02T02:50:06
last_root_post2018-05-02T02:50:06
last_vote_time2018-04-30T05:14:54
proxied_vsf_votes0, 0, 0, 0
can_vote1
voting_power9,800
delayed_votes0
balance0.002 STEEM
savings_balance0.000 STEEM
sbd_balance0.000 SBD
savings_sbd_balance0.751 SBD
vesting_shares108323.292994 VESTS
delegated_vesting_shares0.000000 VESTS
received_vesting_shares0.000000 VESTS
reward_vesting_balance137.959992 VESTS
vesting_balance0.000 STEEM
vesting_withdraw_rate0.000000 VESTS
next_vesting_withdrawal1969-12-31T23:59:59
withdrawn0
to_withdraw0
withdraw_routes0
savings_withdraw_requests0
last_account_recovery1970-01-01T00:00:00
reset_accountnull
last_owner_update1970-01-01T00:00:00
last_account_update2016-12-04T06:39:42
minedNo
sbd_seconds2,377,086,177
sbd_last_interest_payment2018-03-14T13:51:03
savings_sbd_last_interest_payment1970-01-01T00:00:00
{
  "id": 115508,
  "name": "gurureviewer",
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM81N7SUdAeaGqFiHU4eJzG96zA5qQPc8Gjcqa64f5xP1bA3qiF3",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8ZgMSMUjxntUcsAFaiLFyTgD6Qt5fhXkgAZfnmbf9BqqPmrCw5",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8aF767vAyCF1uhBt62fNi2oFisdMB8itLFy6E1PUBsTs2TWyFN",
        1
      ]
    ]
  },
  "memo_key": "STM5i2C3V7KkMphnEUkg1hR6EDvgv152f19AhetDAK2ofKoQmLxDy",
  "json_metadata": "{\"profile\":{\"profile_image\":\"http://gurureviewer.com/wp-content/uploads/2016/04/das-1.jpg\",\"name\":\"gurureviewer\",\"website\":\"http://gurureviewer.com/\"}}",
  "posting_json_metadata": "{\"profile\":{\"profile_image\":\"http://gurureviewer.com/wp-content/uploads/2016/04/das-1.jpg\",\"name\":\"gurureviewer\",\"website\":\"http://gurureviewer.com/\"}}",
  "proxy": "",
  "last_owner_update": "1970-01-01T00:00:00",
  "last_account_update": "2016-12-04T06:39:42",
  "created": "2016-12-04T06:23:36",
  "mined": false,
  "recovery_account": "steem",
  "last_account_recovery": "1970-01-01T00:00:00",
  "reset_account": "null",
  "comment_count": 0,
  "lifetime_vote_count": 0,
  "post_count": 411,
  "can_vote": true,
  "voting_manabar": {
    "current_mana": 9800,
    "last_update_time": 1525065294
  },
  "downvote_manabar": {
    "current_mana": 0,
    "last_update_time": 1480832616
  },
  "voting_power": 9800,
  "balance": "0.002 STEEM",
  "savings_balance": "0.000 STEEM",
  "sbd_balance": "0.000 SBD",
  "sbd_seconds": "2377086177",
  "sbd_seconds_last_update": "2018-04-06T04:40:12",
  "sbd_last_interest_payment": "2018-03-14T13:51:03",
  "savings_sbd_balance": "0.751 SBD",
  "savings_sbd_seconds": "0",
  "savings_sbd_seconds_last_update": "2018-04-06T04:40:12",
  "savings_sbd_last_interest_payment": "1970-01-01T00:00:00",
  "savings_withdraw_requests": 0,
  "reward_sbd_balance": "0.044 SBD",
  "reward_steem_balance": "0.000 STEEM",
  "reward_vesting_balance": "137.959992 VESTS",
  "reward_vesting_steem": "0.067 STEEM",
  "vesting_shares": "108323.292994 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "0.000000 VESTS",
  "vesting_withdraw_rate": "0.000000 VESTS",
  "next_vesting_withdrawal": "1969-12-31T23:59:59",
  "withdrawn": 0,
  "to_withdraw": 0,
  "withdraw_routes": 0,
  "curation_rewards": 37,
  "posting_rewards": 2841,
  "proxied_vsf_votes": [
    0,
    0,
    0,
    0
  ],
  "witnesses_voted_for": 0,
  "last_post": "2018-05-02T02:50:06",
  "last_root_post": "2018-05-02T02:50:06",
  "last_vote_time": "2018-04-30T05:14:54",
  "post_bandwidth": 41283,
  "pending_claimed_accounts": 0,
  "vesting_balance": "0.000 STEEM",
  "reputation": -801587079788,
  "transfer_history": [],
  "market_history": [],
  "post_history": [],
  "vote_history": [],
  "other_history": [],
  "witness_votes": [],
  "tags_usage": [],
  "guest_bloggers": [],
  "rank": 27218
}

Withdraw Routes

IncomingOutgoing
Empty
Empty
{
  "incoming": [],
  "outgoing": []
}
From Date
To Date
2022/06/03 04:33:30
authorgurureviewer
permlink215-ways-to-make-money-online-review-this-26-chapter-video-course-and-pdf-is-the-most-comprehensive-up-to-date-program-that
voterfrederick0679
weight10000 (100.00%)
Transaction InfoBlock #64725626/Trx 4aef87ef23fc6a5f8ed4a92356d879547d04acf1
View Raw JSON Data
{
  "block": 64725626,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "215-ways-to-make-money-online-review-this-26-chapter-video-course-and-pdf-is-the-most-comprehensive-up-to-date-program-that",
      "voter": "frederick0679",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2022-06-03T04:33:30",
  "trx_id": "4aef87ef23fc6a5f8ed4a92356d879547d04acf1",
  "trx_in_block": 3,
  "virtual_op": 0
}
2020/12/16 17:12:06
authorgurureviewer
permlinkfiverr-atm-method-by-tony-norton-review-fiverr-atm-method-review
voterwarubro
weight-10000 (-100.00%)
Transaction InfoBlock #49503740/Trx 7f5e9613c132b5a682292736d6093adc4143d2f4
View Raw JSON Data
{
  "block": 49503740,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "fiverr-atm-method-by-tony-norton-review-fiverr-atm-method-review",
      "voter": "warubro",
      "weight": -10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2020-12-16T17:12:06",
  "trx_id": "7f5e9613c132b5a682292736d6093adc4143d2f4",
  "trx_in_block": 4,
  "virtual_op": 0
}
2019/12/04 07:29:42
authorsteemitboard
bodyCongratulations @gurureviewer! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@gurureviewer/birthday3.png</td><td>Happy Birthday! - You are on the Steem blockchain for 3 years!</td></tr></table> <sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@gurureviewer) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=gurureviewer)_</sub> ###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
parent authorgurureviewer
parent permlinkweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
permlinksteemitboard-notify-gurureviewer-20191204t072941000z
title
Transaction InfoBlock #38736377/Trx 521f8c465a25becc1def73ff7f7ead9c21b94d35
View Raw JSON Data
{
  "block": 38736377,
  "op": [
    "comment",
    {
      "author": "steemitboard",
      "body": "Congratulations @gurureviewer! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@gurureviewer/birthday3.png</td><td>Happy Birthday! - You are on the Steem blockchain for 3 years!</td></tr></table>\n\n<sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@gurureviewer) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=gurureviewer)_</sub>\n\n\n###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}",
      "parent_author": "gurureviewer",
      "parent_permlink": "weight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "permlink": "steemitboard-notify-gurureviewer-20191204t072941000z",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2019-12-04T07:29:42",
  "trx_id": "521f8c465a25becc1def73ff7f7ead9c21b94d35",
  "trx_in_block": 4,
  "virtual_op": 0
}
2018/12/04 07:32:21
authorsteemitboard
bodyCongratulations @gurureviewer! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@gurureviewer/birthday2.png</td><td>2 Years on Steemit</td></tr></table> <sub>_[Click here to view your Board of Honor](https://steemitboard.com/@gurureviewer)_</sub> **Do not miss the last post from @steemitboard:** <table><tr><td><a href="https://steemit.com/steemitboard/@steemitboard/5jrq2c-steemitboard-saint-nicholas-day"><img src="https://steemitimages.com/64x128/http://i.cubeupload.com/mGo2Zd.png"></a></td><td><a href="https://steemit.com/steemitboard/@steemitboard/5jrq2c-steemitboard-saint-nicholas-day">Saint Nicholas challenge for good boys and girls</a></td></tr></table> > Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
parent authorgurureviewer
parent permlinkweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
permlinksteemitboard-notify-gurureviewer-20181204t073220000z
title
Transaction InfoBlock #28262309/Trx 69d14735b4ef7e23b8063ed1418329cf98c0ae81
View Raw JSON Data
{
  "block": 28262309,
  "op": [
    "comment",
    {
      "author": "steemitboard",
      "body": "Congratulations @gurureviewer! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@gurureviewer/birthday2.png</td><td>2 Years on Steemit</td></tr></table>\n\n<sub>_[Click here to view your Board of Honor](https://steemitboard.com/@gurureviewer)_</sub>\n\n\n**Do not miss the last post from @steemitboard:**\n<table><tr><td><a href=\"https://steemit.com/steemitboard/@steemitboard/5jrq2c-steemitboard-saint-nicholas-day\"><img src=\"https://steemitimages.com/64x128/http://i.cubeupload.com/mGo2Zd.png\"></a></td><td><a href=\"https://steemit.com/steemitboard/@steemitboard/5jrq2c-steemitboard-saint-nicholas-day\">Saint Nicholas challenge for good boys and girls</a></td></tr></table>\n\n> Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}",
      "parent_author": "gurureviewer",
      "parent_permlink": "weight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "permlink": "steemitboard-notify-gurureviewer-20181204t073220000z",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-12-04T07:32:21",
  "trx_id": "69d14735b4ef7e23b8063ed1418329cf98c0ae81",
  "trx_in_block": 3,
  "virtual_op": 0
}
2018/05/05 04:29:09
authorgurureviewer
permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
sbd payout0.011 SBD
steem payout0.000 STEEM
vesting payout8.144344 VESTS
Transaction InfoBlock #22154146/Virtual Operation #3
View Raw JSON Data
{
  "block": 22154146,
  "op": [
    "author_reward",
    {
      "author": "gurureviewer",
      "permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "sbd_payout": "0.011 SBD",
      "steem_payout": "0.000 STEEM",
      "vesting_payout": "8.144344 VESTS"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-05T04:29:09",
  "trx_id": "0000000000000000000000000000000000000000",
  "trx_in_block": 4294967295,
  "virtual_op": 3
}
2018/05/02 02:51:00
authorgurureviewer
permlinkweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
voterhackerzizon
weight400 (4.00%)
Transaction InfoBlock #22065806/Trx d95e16d632f1011bc8ddfceee4ade03ab832c798
View Raw JSON Data
{
  "block": 22065806,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "weight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "voter": "hackerzizon",
      "weight": 400
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:51:00",
  "trx_id": "d95e16d632f1011bc8ddfceee4ade03ab832c798",
  "trx_in_block": 7,
  "virtual_op": 0
}
2018/05/02 02:50:51
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
permlinkcheetah-re-gurureviewerweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
title
Transaction InfoBlock #22065803/Trx f65f82101e5c3639649e682411852eabe1d53303
View Raw JSON Data
{
  "block": 22065803,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "weight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "permlink": "cheetah-re-gurureviewerweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:50:51",
  "trx_id": "f65f82101e5c3639649e682411852eabe1d53303",
  "trx_in_block": 23,
  "virtual_op": 0
}
2018/05/02 02:50:30
authorgurureviewer
permlinkweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #22065796/Trx e11329d3328ba628b445ea60a430c2e4c97dac0c
View Raw JSON Data
{
  "block": 22065796,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "weight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:50:30",
  "trx_id": "e11329d3328ba628b445ea60a430c2e4c97dac0c",
  "trx_in_block": 49,
  "virtual_op": 0
}
2018/05/02 02:50:06
authorgurureviewer
bodyWeight Loss Niche Domination is an in-depth, 11-step training program that teaches you how to cash in on the multi-billion-dollar weight loss craze. A craze that only gets bigger and bigger year after year. The creator’ll have them doing so by building video blogs, complete with lots of great, highly engaging written content. Your blogs will be monetized with affiliate banners, affiliate links, Your own squeeze page banners, native ads, and good ol’ Google Adsense! You will also be loading your autoresponder follow-up sequence with highly engaging, sequential, and beautifully monetized emails. Long, juicy, relationship-building emails that will get you paid! And will you be writing these emails yourself? Nay, compadre. Because THAT is where this offer REALLY gets interesting. The creators provide you with the emails… and the lead magnet… and the squeeze page template… and the blog content! Check more here : https://reviewjvzoo.com/weight-loss-niche-domination-by-lee-murray-review-how-to-make-a-fortune-in-the-168960000000-168-96-billion-dollar-weight-loss-niche-fast-unlike-anything-youve-ever-seen/ Tags : Weight Loss Niche Domination, Weight Loss Niche Domination review, Demo Weight Loss Niche Domination by Lee Murray review, Weight Loss Niche Domination by Lee Murray, Weight Loss Niche Domination by Lee Murray- Should you Buy It?, Weight Loss Niche Domination by Lee Murray- The best prices, Weight Loss Niche Domination by Lee MurrayA Quick Peek Inside, Weight Loss Niche Domination by Lee MurrayBonus, Weight Loss Niche Domination by Lee MurrayBonuses, Weight Loss Niche Domination by Lee MurrayBuy, Weight Loss Niche Domination by Lee MurrayDiscount And Massive Bonus, Weight Loss Niche Domination by Lee MurrayHonest Review, Weight Loss Niche Domination by Lee MurrayHow to Buy?, Weight Loss Niche Domination by Lee MurrayIs It Worth It?, Weight Loss Niche Domination by Lee MurrayMega Bonus, Weight Loss Niche Domination by Lee MurrayReview, Weight Loss Niche Domination by Lee MurrayReview And Bonus Buy Here, Weight Loss Niche Domination by Lee MurrayReview And Bonus Buy With Confidence, Weight Loss Niche Domination by Lee MurrayReview And Bonus Do I Really Need it, Weight Loss Niche Domination by Lee MurrayShould I buy it?, Weight Loss Niche Domination by Lee MurrayWho is thisfor?, Weight Loss Niche Domination by Lee Murray OTO1, Weight Loss Niche Domination by Lee Murray OTO2, review Weight Loss Niche Domination by Lee Murray
json metadata{"tags":["weightlossniche","domination","byleemurray","review"],"links":["https://reviewjvzoo.com/weight-loss-niche-domination-by-lee-murray-review-how-to-make-a-fortune-in-the-168960000000-168-96-billion-dollar-weight-loss-niche-fast-unlike-anything-youve-ever-seen/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkweightlossniche
permlinkweight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review
titleWeight Loss Niche Domination by Lee Murray Review , Weight Loss Niche Domination Review
Transaction InfoBlock #22065788/Trx bb1d835c37482098c320865ba3702ef012d5b66c
View Raw JSON Data
{
  "block": 22065788,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Weight Loss Niche Domination is an in-depth, 11-step training program that teaches you how to cash in on the multi-billion-dollar weight loss craze. A craze that only gets bigger and bigger year after year. The creator’ll have them doing so by building video blogs, complete with lots of great, highly engaging written content. Your blogs will be monetized with affiliate banners, affiliate links, Your own squeeze page banners, native ads, and good ol’ Google Adsense!\n\nYou will also be loading your autoresponder follow-up sequence with highly engaging, sequential, and beautifully monetized emails. Long, juicy, relationship-building emails that will get you paid!\n\nAnd will you be writing these emails yourself? Nay, compadre. Because THAT is where this offer REALLY gets interesting. The creators provide you with the emails… and the lead magnet… and the squeeze page template… and the blog content!\n\nCheck more here :\nhttps://reviewjvzoo.com/weight-loss-niche-domination-by-lee-murray-review-how-to-make-a-fortune-in-the-168960000000-168-96-billion-dollar-weight-loss-niche-fast-unlike-anything-youve-ever-seen/\n\nTags : Weight Loss Niche Domination, Weight Loss Niche Domination review, Demo Weight Loss Niche Domination by Lee Murray review, Weight Loss Niche Domination by Lee Murray, Weight Loss Niche Domination by Lee Murray- Should you Buy It?, Weight Loss Niche Domination by Lee Murray- The best prices, Weight Loss Niche Domination by Lee MurrayA Quick Peek Inside, Weight Loss Niche Domination by Lee MurrayBonus, Weight Loss Niche Domination by Lee MurrayBonuses, Weight Loss Niche Domination by Lee MurrayBuy, Weight Loss Niche Domination by Lee MurrayDiscount And Massive Bonus, Weight Loss Niche Domination by Lee MurrayHonest Review, Weight Loss Niche Domination by Lee MurrayHow to Buy?, Weight Loss Niche Domination by Lee MurrayIs It Worth It?, Weight Loss Niche Domination by Lee MurrayMega Bonus, Weight Loss Niche Domination by Lee MurrayReview, Weight Loss Niche Domination by Lee MurrayReview And Bonus Buy Here, Weight Loss Niche Domination by Lee MurrayReview And Bonus Buy With Confidence, Weight Loss Niche Domination by Lee MurrayReview And Bonus Do I Really Need it, Weight Loss Niche Domination by Lee MurrayShould I buy it?, Weight Loss Niche Domination by Lee MurrayWho is thisfor?, Weight Loss Niche Domination by Lee Murray OTO1, Weight Loss Niche Domination by Lee Murray OTO2, review Weight Loss Niche Domination by Lee Murray",
      "json_metadata": "{\"tags\":[\"weightlossniche\",\"domination\",\"byleemurray\",\"review\"],\"links\":[\"https://reviewjvzoo.com/weight-loss-niche-domination-by-lee-murray-review-how-to-make-a-fortune-in-the-168960000000-168-96-billion-dollar-weight-loss-niche-fast-unlike-anything-youve-ever-seen/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "weightlossniche",
      "permlink": "weight-loss-niche-domination-by-lee-murray-review-weight-loss-niche-domination-review",
      "title": "Weight Loss Niche Domination by Lee Murray Review , Weight Loss Niche Domination Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:50:06",
  "trx_id": "bb1d835c37482098c320865ba3702ef012d5b66c",
  "trx_in_block": 9,
  "virtual_op": 0
}
2018/05/02 02:12:12
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkthe-breakthrough-with-kenny-cannon-review-the-breakthrough-review
permlinkcheetah-re-gurureviewerthe-breakthrough-with-kenny-cannon-review-the-breakthrough-review
title
Transaction InfoBlock #22065030/Trx 2696df94acf605713ba60313220bd996c27fc8a7
View Raw JSON Data
{
  "block": 22065030,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "the-breakthrough-with-kenny-cannon-review-the-breakthrough-review",
      "permlink": "cheetah-re-gurureviewerthe-breakthrough-with-kenny-cannon-review-the-breakthrough-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:12:12",
  "trx_id": "2696df94acf605713ba60313220bd996c27fc8a7",
  "trx_in_block": 33,
  "virtual_op": 0
}
2018/05/02 02:12:09
authorgurureviewer
permlinkthe-breakthrough-with-kenny-cannon-review-the-breakthrough-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #22065029/Trx 5620c0f5bae0766ccb5d9279dcd741039d98400c
View Raw JSON Data
{
  "block": 22065029,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "the-breakthrough-with-kenny-cannon-review-the-breakthrough-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:12:09",
  "trx_id": "5620c0f5bae0766ccb5d9279dcd741039d98400c",
  "trx_in_block": 25,
  "virtual_op": 0
}
2018/05/02 02:12:03
authorgurureviewer
bodyThe Breakthrough With Kenny Cannon is The new way of generating income streams online that pulls in $200 per day Plus adds recurring revenue to any business even if you’ve failed in the past or have ‘tried everything’. The beauty of the The Breakthrough is that it helps put extra cash in your pocket whether you are still a newbie or an experienced marketer. Think about this…How would you like to go from where you are now to having 5 figure months and being done with “work” by 10AM every day??? If that’s the lifestyle you want (and who wouldn’t) then “The Breakthrough” is for you.. Check more here : https://reviewjvzoo.com/the-breakthrough-with-kenny-cannon-review-finally-a-done-with-you-mentorship-program-that-cuts-straight-through-the-bs-and-forces-even-the-newest-of-newbies-to-start-making-a-minimum-of-200-pe/ Tags : The Breakthrough, The Breakthrough review, Demo The Breakthrough With Kenny Cannon review, The Breakthrough With Kenny Cannon, The Breakthrough With Kenny Cannon- Should you Buy It?, The Breakthrough With Kenny Cannon- The best prices, The Breakthrough With Kenny CannonA Quick Peek Inside, The Breakthrough With Kenny CannonBonus, The Breakthrough With Kenny CannonBonuses, The Breakthrough With Kenny CannonBuy, The Breakthrough With Kenny CannonDiscount And Massive Bonus, The Breakthrough With Kenny CannonHonest Review, The Breakthrough With Kenny CannonHow to Buy?, The Breakthrough With Kenny CannonIs It Worth It?, The Breakthrough With Kenny CannonMega Bonus, The Breakthrough With Kenny CannonReview, The Breakthrough With Kenny CannonReview And Bonus Buy Here, The Breakthrough With Kenny CannonReview And Bonus Buy With Confidence, The Breakthrough With Kenny CannonReview And Bonus Do I Really Need it, The Breakthrough With Kenny CannonShould I buy it?, The Breakthrough With Kenny CannonWho is thisfor?, The Breakthrough With Kenny Cannon OTO1, The Breakthrough With Kenny Cannon OTO2, review The Breakthrough With Kenny Cannon
json metadata{"tags":["thebreakthrough","withkennycannon","review"],"links":["https://reviewjvzoo.com/the-breakthrough-with-kenny-cannon-review-finally-a-done-with-you-mentorship-program-that-cuts-straight-through-the-bs-and-forces-even-the-newest-of-newbies-to-start-making-a-minimum-of-200-pe/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkthebreakthrough
permlinkthe-breakthrough-with-kenny-cannon-review-the-breakthrough-review
titleThe Breakthrough With Kenny Cannon review , The Breakthrough review
Transaction InfoBlock #22065027/Trx e86bada26c402a3ad5cf86929c2c95df6e39e9c7
View Raw JSON Data
{
  "block": 22065027,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "The Breakthrough With Kenny Cannon is The new way of generating income streams online that pulls in $200 per day Plus adds recurring revenue to any business even if you’ve failed in the past or have ‘tried everything’. The beauty of the The Breakthrough is that it helps put extra cash in your pocket whether you are still a newbie or an experienced marketer. Think about this…How would you like to go from where you are now to having 5 figure months and being done with “work” by 10AM every day??? If that’s the lifestyle you want (and who wouldn’t) then “The Breakthrough” is for you..\n\nCheck more here :\nhttps://reviewjvzoo.com/the-breakthrough-with-kenny-cannon-review-finally-a-done-with-you-mentorship-program-that-cuts-straight-through-the-bs-and-forces-even-the-newest-of-newbies-to-start-making-a-minimum-of-200-pe/\n\nTags : The Breakthrough, The Breakthrough review, Demo The Breakthrough With Kenny Cannon review, The Breakthrough With Kenny Cannon, The Breakthrough With Kenny Cannon- Should you Buy It?, The Breakthrough With Kenny Cannon- The best prices, The Breakthrough With Kenny CannonA Quick Peek Inside, The Breakthrough With Kenny CannonBonus, The Breakthrough With Kenny CannonBonuses, The Breakthrough With Kenny CannonBuy, The Breakthrough With Kenny CannonDiscount And Massive Bonus, The Breakthrough With Kenny CannonHonest Review, The Breakthrough With Kenny CannonHow to Buy?, The Breakthrough With Kenny CannonIs It Worth It?, The Breakthrough With Kenny CannonMega Bonus, The Breakthrough With Kenny CannonReview, The Breakthrough With Kenny CannonReview And Bonus Buy Here, The Breakthrough With Kenny CannonReview And Bonus Buy With Confidence, The Breakthrough With Kenny CannonReview And Bonus Do I Really Need it, The Breakthrough With Kenny CannonShould I buy it?, The Breakthrough With Kenny CannonWho is thisfor?, The Breakthrough With Kenny Cannon OTO1, The Breakthrough With Kenny Cannon OTO2, review The Breakthrough With Kenny Cannon",
      "json_metadata": "{\"tags\":[\"thebreakthrough\",\"withkennycannon\",\"review\"],\"links\":[\"https://reviewjvzoo.com/the-breakthrough-with-kenny-cannon-review-finally-a-done-with-you-mentorship-program-that-cuts-straight-through-the-bs-and-forces-even-the-newest-of-newbies-to-start-making-a-minimum-of-200-pe/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "thebreakthrough",
      "permlink": "the-breakthrough-with-kenny-cannon-review-the-breakthrough-review",
      "title": "The Breakthrough With Kenny Cannon review , The Breakthrough review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-05-02T02:12:03",
  "trx_id": "e86bada26c402a3ad5cf86929c2c95df6e39e9c7",
  "trx_in_block": 34,
  "virtual_op": 0
}
2018/04/30 05:44:39
authorgurureviewer
permlinkthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
votermoby-dick
weight10000 (100.00%)
Transaction InfoBlock #22011692/Trx ccf2f7228b90bffe866a2a2e74356d997b9e33f2
View Raw JSON Data
{
  "block": 22011692,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "thinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "voter": "moby-dick",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-30T05:44:39",
  "trx_id": "ccf2f7228b90bffe866a2a2e74356d997b9e33f2",
  "trx_in_block": 19,
  "virtual_op": 0
}
2018/04/30 05:14:54
authorgurureviewer
permlinkthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #22011097/Trx d52eff505738275f50a14816986569f252164b50
View Raw JSON Data
{
  "block": 22011097,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "thinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-30T05:14:54",
  "trx_id": "d52eff505738275f50a14816986569f252164b50",
  "trx_in_block": 36,
  "virtual_op": 0
}
2018/04/30 04:46:30
authorgurureviewer
permlinkthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
voterhackerzizon
weight400 (4.00%)
Transaction InfoBlock #22010529/Trx a15b612f9be5f840cf99d840023b5740a3c60ff8
View Raw JSON Data
{
  "block": 22010529,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "thinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "voter": "hackerzizon",
      "weight": 400
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-30T04:46:30",
  "trx_id": "a15b612f9be5f840cf99d840023b5740a3c60ff8",
  "trx_in_block": 6,
  "virtual_op": 0
}
2018/04/30 04:45:45
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
permlinkcheetah-re-gurureviewerthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
title
Transaction InfoBlock #22010514/Trx 9830b069d40f277e36107f28940b7d998b10dd6b
View Raw JSON Data
{
  "block": 22010514,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "thinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "permlink": "cheetah-re-gurureviewerthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-30T04:45:45",
  "trx_id": "9830b069d40f277e36107f28940b7d998b10dd6b",
  "trx_in_block": 25,
  "virtual_op": 0
}
2018/04/30 04:45:42
authorgurureviewer
permlinkthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #22010513/Trx 2042c8b00b161aa6b1ce6de943b7f01b8c0f5ee0
View Raw JSON Data
{
  "block": 22010513,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "thinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-30T04:45:42",
  "trx_id": "2042c8b00b161aa6b1ce6de943b7f01b8c0f5ee0",
  "trx_in_block": 23,
  "virtual_op": 0
}
2018/04/30 04:45:33
authorgurureviewer
bodyeCom Secrets is a content-packed and straight to the point eBook and video course which details the most powerful secrets the authors have learned over the last 2 years in our highly successful eCom brands. Their businesses have generated over $700,000 in the last 12 months and along the way they have learned extremely powerful (and profitable) lessons. The training is going to help you finally build a stable income online. This is like nothing you have ever seen before. They are LITERALLY teaching the opposite of every eCom and physical product guru out there. They are going to reveal to you how you can get your hands on those secrets. The secrets strategies that they have developed after spending tens of thousand of dollars on traffic and thousands of hours of trying, failing and finally succeeding! The authors will also show you how you can get access to these secrets for less than the price of lunch and how these EXACT strategies have meant while everybody else is closing the doors to their physical product businesses we are doing better than ever! What Will You Learn In Thinking Big eCom? – 6 Week Course ThinkingBig eCom is a 6 week step by step course – All Your Questions Answered Get access to a private Fb group, where we will answer whatever questions you may have. And get encouragement and ideas from other members. – Critique Your Businesses Each week we will hold a live webinar where we can critique your businesses, give you our ideas, teach new strategies as we learn them. Each webinar will be available for you in the members area. – Follow Us Live We will follow along with you as we build a brand new store and powerful brand right before your eyes! (VALUABLE) – 1 Module Per Week You will get access to a module a week and documents so you can follow along easily – Beginner or Advanced This is perfect for complete beginners or if you have a store you want to reinvent – Over The Shoulder Each module has multiple over the shoulder videos, showing you exactly how we go from nothing to owning a long term, stable business – Research In Ways You Have Never Seen Discover how we do solid research in ways you have never seen before! Uncover wildly profitable niches you didn’t even know exist. Be certain they will work before you even start! – New And Innovative Products Learn how we source new and innovative products that are unique to you – Stand Our From The Competition Brand those products, add value and stand out from your competition – See How WE Do It See how we create high converting websites. And not just the stores, you need to be engaging in your niche with regular content (You don’t need to create this either!) – How To Get Around The LATEST Facebook Ad Costs Facebook is getting very expensive, we will teach you how to get around this with brilliant ad campaigns (works in every niche) – Other Traffic Platforms Learn about other traffic platforms, don’t put all your eggs in one basket – Conquering The Biggest Platform Discover how to RAPIDLY expand your business by conquering the biggest platform of them all – NO Secrets There will be no secrets from us, we will share suppliers, designers, product vendors, the EXACT tools we use on our websites to see the results we do. – We Take Your Brand To The Moon And finally, take your brand to the moon and become a well known, trusted business that people love to interact with and buy from. And how to polish your “perceived value” to compete with the big boys The Training of Thinking Big eCom by Kevin Byrne : – Module 1: In module 1 we will provide you with a templated worksheet which will guide you through the research process to GUARANTEE that you know everything there is to know about your chosen niche and products. Following along with us as we build a new brand, will help you to make sure that your niche and products are in demand and you have a solid plan you can follow as you begin your adventure. We will show you a level of research you would normally have to pay tens of thousands of dollars for coaching. – Module 2: In this module we will cover products. This isn’t your average eCom product training. We use Aliexpress and Alibaba in VERY different ways to anybody else. We will teach you to do the OPPOSITE to everybody else. To create a long term, recognizable brand that you can be proud of.Follow along with us as we find new products, work out deals with suppliers, make existing products even better and add tons of value making our products POP! – Module 3: In this module you will discover how we setup our website for success. How we create high converting, beautiful websites that scream high quality and are instantly recognisable as being YOUR BRAND! We will show you how we use custom photography, create and edit custom videos, how we develop modern and eye catching designs. Our stores stand out, and so will yours. And it’s not just the store that’s important. It’s the whole brand. We will show you how to put out amazing content, interact with your customers and create a brand that dazzles in every way. – Module 4: In this module we will talk traffic. Facebook advertisers have been battered and bruised recently and advertising costs have gone way up. But, there are ways around this and we will show you techniques that will help you generate much cheaper traffic across a diverse range of sources than your competition. – Module 5: Module 5 will deal with the daddy of all physical product platforms; Amazon! Over the years we have done VERY well with Amazon, but again things have changed. We will show you how to dominate the Amazon rankings, automate your sales and expand your brand and business beyond anything you ever imagined. – Module 6: Your brand, in this final module we will show you how to go from a small brand, to a recognised and trusted well known name. How to hire staff, outsource, expand your product range, strike deals with suppliers and create amazing content that will turn your followers into raving fans! Check Here : https://reviewjvzoo.com/thinking-big-ecom-secrets-by-kevin-byrne-review-discover-how-2-average-guys-generated-over-700000-in-12-months-with-zero-ecom-experience-straight-to-the-point-manual-and-video-t/ Tags : Tags : Buy ThinkingBig-eCom, Get ThinkingBig-eCom, Thinking Big eCom by Kevin Byrne, Thinking Big eCom by Simon Greenhalgh, ThinkingBig-eCom by Kevin Byrne, ThinkingBig-eCom by Kevin Byrne Amazon, ThinkingBig-eCom by Kevin Byrne Benefits, ThinkingBig-eCom by Kevin Byrne Bonus, ThinkingBig-eCom by Kevin Byrne Demo Software, ThinkingBig-eCom by Kevin Byrne Download, ThinkingBig-eCom by Kevin Byrne eCommerce, ThinkingBig-eCom by Kevin Byrne Features, ThinkingBig-eCom by Kevin Byrne JVZoo, ThinkingBig-eCom by Kevin Byrne Module, ThinkingBig-eCom by Kevin Byrne OTO Upsell, ThinkingBig-eCom by Kevin Byrne Pro Price, ThinkingBig-eCom by Kevin Byrne Pro Review, ThinkingBig-eCom by Kevin Byrne Review, ThinkingBig-eCom by Kevin Byrne Video Training, ThinkingBig-eCom by Kevin Byrne Warriorforum, ThinkingBig-eCom Done For You
json metadata{"tags":["thinkingbigecomsecrets","bykevinbyrnereview","ecomsecretsreview"],"links":["https://reviewjvzoo.com/thinking-big-ecom-secrets-by-kevin-byrne-review-discover-how-2-average-guys-generated-over-700000-in-12-months-with-zero-ecom-experience-straight-to-the-point-manual-and-video-t/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkthinkingbigecomsecrets
permlinkthinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review
titleThinking Big eCom Secrets By Kevin Byrne Review , Thinking Big eCom Secrets Review
Transaction InfoBlock #22010510/Trx 0d00bfea20b59422c88599b09496e6b7a2503c58
View Raw JSON Data
{
  "block": 22010510,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "eCom Secrets is a content-packed and straight to the point eBook and video course which details the most powerful secrets the authors have learned over the last 2 years in our highly successful eCom brands. Their businesses have generated over $700,000 in the last 12 months and along the way they have learned extremely powerful (and profitable) lessons.\n\nThe training is going to help you finally build a stable income online. This is like nothing you have ever seen before. They are LITERALLY teaching the opposite of every eCom and physical product guru out there. They are going to reveal to you how you can get your hands on those secrets. The secrets strategies that they have developed after spending tens of thousand of dollars on traffic and thousands of hours of trying, failing and finally succeeding!\n\nThe authors will also show you how you can get access to these secrets for less than the price of lunch and how these EXACT strategies have meant while everybody else is closing the doors to their physical product businesses we are doing better than ever!\n\nWhat Will You Learn In Thinking Big eCom?\n– 6 Week Course\nThinkingBig eCom is a 6 week step by step course\n– All Your Questions Answered\nGet access to a private Fb group, where we will answer whatever questions you may have. And get encouragement and ideas from other members.\n– Critique Your Businesses\nEach week we will hold a live webinar where we can critique your businesses, give you our ideas, teach new strategies as we learn them. Each webinar will be available for you in the members area.\n– Follow Us Live\nWe will follow along with you as we build a brand new store and powerful brand right before your eyes! (VALUABLE)\n– 1 Module Per Week\nYou will get access to a module a week and documents so you can follow along easily\n– Beginner or Advanced\nThis is perfect for complete beginners or if you have a store you want to reinvent\n– Over The Shoulder\nEach module has multiple over the shoulder videos, showing you exactly how we go from nothing to owning a long term, stable business\n– Research In Ways You Have Never Seen\nDiscover how we do solid research in ways you have never seen before! Uncover wildly profitable niches you didn’t even know exist. Be certain they will work before you even start!\n– New And Innovative Products\nLearn how we source new and innovative products that are unique to you\n– Stand Our From The Competition\nBrand those products, add value and stand out from your competition\n– See How WE Do It\nSee how we create high converting websites. And not just the stores, you need to be engaging in your niche with regular content (You don’t need to create this either!)\n– How To Get Around The LATEST Facebook Ad Costs\nFacebook is getting very expensive, we will teach you how to get around this with brilliant ad campaigns (works in every niche)\n– Other Traffic Platforms\nLearn about other traffic platforms, don’t put all your eggs in one basket\n– Conquering The Biggest Platform\nDiscover how to RAPIDLY expand your business by conquering the biggest platform of them all\n– NO Secrets\nThere will be no secrets from us, we will share suppliers, designers, product vendors, the EXACT tools we use on our websites to see the results we do.\n– We Take Your Brand To The Moon\nAnd finally, take your brand to the moon and become a well known, trusted business that people love to interact with and buy from. And how to polish your “perceived value” to compete with the big boys\n\nThe Training of Thinking Big eCom by Kevin Byrne :\n– Module 1:\nIn module 1 we will provide you with a templated worksheet which will guide you through the research process to GUARANTEE that you know everything there is to know about your chosen niche and products. Following along with us as we build a new brand, will help you to make sure that your niche and products are in demand and you have a solid plan you can follow as you begin your adventure. We will show you a level of research you would normally have to pay tens of thousands of dollars for coaching.\n– Module 2:\nIn this module we will cover products. This isn’t your average eCom product training. We use Aliexpress and Alibaba in VERY different ways to anybody else. We will teach you to do the OPPOSITE to everybody else. To create a long term, recognizable brand that you can be proud of.Follow along with us as we find new products, work out deals with suppliers, make existing products even better and add tons of value making our products POP!\n– Module 3:\nIn this module you will discover how we setup our website for success. How we create high converting, beautiful websites that scream high quality and are instantly recognisable as being YOUR BRAND! We will show you how we use custom photography, create and edit custom videos, how we develop modern and eye catching designs. Our stores stand out, and so will yours. And it’s not just the store that’s important. It’s the whole brand. We will show you how to put out amazing content, interact with your customers and create a brand that dazzles in every way.\n– Module 4:\nIn this module we will talk traffic. Facebook advertisers have been battered and bruised recently and advertising costs have gone way up. But, there are ways around this and we will show you techniques that will help you generate much cheaper traffic across a diverse range of sources than your competition.\n– Module 5:\nModule 5 will deal with the daddy of all physical product platforms; Amazon! Over the years we have done VERY well with Amazon, but again things have changed. We will show you how to dominate the Amazon rankings, automate your sales and expand your brand and business beyond anything you ever imagined.\n– Module 6:\nYour brand, in this final module we will show you how to go from a small brand, to a recognised and trusted well known name. How to hire staff, outsource, expand your product range, strike deals with suppliers and create amazing content that will turn your followers into raving fans!\n\nCheck Here :\nhttps://reviewjvzoo.com/thinking-big-ecom-secrets-by-kevin-byrne-review-discover-how-2-average-guys-generated-over-700000-in-12-months-with-zero-ecom-experience-straight-to-the-point-manual-and-video-t/\n\nTags : Tags : Buy ThinkingBig-eCom, Get ThinkingBig-eCom, Thinking Big eCom by Kevin Byrne, Thinking Big eCom by Simon Greenhalgh, ThinkingBig-eCom by Kevin Byrne, ThinkingBig-eCom by Kevin Byrne Amazon, ThinkingBig-eCom by Kevin Byrne Benefits, ThinkingBig-eCom by Kevin Byrne Bonus, ThinkingBig-eCom by Kevin Byrne Demo Software, ThinkingBig-eCom by Kevin Byrne Download, ThinkingBig-eCom by Kevin Byrne eCommerce, ThinkingBig-eCom by Kevin Byrne Features, ThinkingBig-eCom by Kevin Byrne JVZoo, ThinkingBig-eCom by Kevin Byrne Module, ThinkingBig-eCom by Kevin Byrne OTO Upsell, ThinkingBig-eCom by Kevin Byrne Pro Price, ThinkingBig-eCom by Kevin Byrne Pro Review, ThinkingBig-eCom by Kevin Byrne Review, ThinkingBig-eCom by Kevin Byrne Video Training, ThinkingBig-eCom by Kevin Byrne Warriorforum, ThinkingBig-eCom Done For You",
      "json_metadata": "{\"tags\":[\"thinkingbigecomsecrets\",\"bykevinbyrnereview\",\"ecomsecretsreview\"],\"links\":[\"https://reviewjvzoo.com/thinking-big-ecom-secrets-by-kevin-byrne-review-discover-how-2-average-guys-generated-over-700000-in-12-months-with-zero-ecom-experience-straight-to-the-point-manual-and-video-t/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "thinkingbigecomsecrets",
      "permlink": "thinking-big-ecom-secrets-by-kevin-byrne-review-thinking-big-ecom-secrets-review",
      "title": "Thinking Big eCom Secrets By Kevin Byrne Review , Thinking Big eCom Secrets Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-30T04:45:33",
  "trx_id": "0d00bfea20b59422c88599b09496e6b7a2503c58",
  "trx_in_block": 33,
  "virtual_op": 0
}
2018/04/29 15:34:03
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkvideo-business-academy-by-howard-lynch-review-video-business-academy-review
permlinkcheetah-re-gurureviewervideo-business-academy-by-howard-lynch-review-video-business-academy-review
title
Transaction InfoBlock #21994684/Trx f9d793e3498130771ff2a19c86169cc367516b74
View Raw JSON Data
{
  "block": 21994684,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "video-business-academy-by-howard-lynch-review-video-business-academy-review",
      "permlink": "cheetah-re-gurureviewervideo-business-academy-by-howard-lynch-review-video-business-academy-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T15:34:03",
  "trx_id": "f9d793e3498130771ff2a19c86169cc367516b74",
  "trx_in_block": 19,
  "virtual_op": 0
}
2018/04/29 15:33:57
authorgurureviewer
permlinkvideo-business-academy-by-howard-lynch-review-video-business-academy-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21994682/Trx 360a01e043c5c42b37d1d3b8a79d9820ee94159f
View Raw JSON Data
{
  "block": 21994682,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "video-business-academy-by-howard-lynch-review-video-business-academy-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T15:33:57",
  "trx_id": "360a01e043c5c42b37d1d3b8a79d9820ee94159f",
  "trx_in_block": 41,
  "virtual_op": 0
}
2018/04/29 15:33:51
authorgurureviewer
bodyVideo Business Academy is the blueprint of this successful marketing method and works because of 4 very importants points. Video Business Academy has been live for two days now, and customers are RAVING about it. Not only do you get this powerful training that GUARANTEES you make money. Video Business Academy is going STRONG right now, and if you’ve been on the fence about getting this crazy method, then you should seriously take a look at it now. Video Business Academy Profits : - This is a full system showing you LIVE how using two free websites can add $150+ a day to your pocket from day one - This is without a doubt the system I’d use if I had to start over -and was designed with beginners in mind (although everyone can benefit from using it - You can start doing it today, without any red tape or initial investment, and everything is taught in 32 bite-sized HD videos Testimonial : <iframe width="827" height="465" src="https://www.youtube.com/embed/g1xi1BOcOiA" frameborder="0" allow="autoplay; encrypted-media" allowfullscreen></iframe> Check More here : https://reviewjvzoo.com/video-business-academy-by-howard-lynch-review-discover-the-unique-method-to-generates-2000-to-3190-a-month-while-requiring-only-half-an-hour-of-work-each-day-and-no-upfront-investment-or-expen/ Tags : Video Business Academy, Video Business Academy Bonus and Download by Howard Lynch, Video Business Academy by Howard Lynch Download, Video Business Academy by Howard Lynch JVzoo, Video Business Academy by Howard Lynch OTO Upsell, Video Business Academy by Howard Lynch Review, Video Business Academy by Howard Lynch Review Pro Bonus and Download, Video Business Academy by Howard Lynch Tutorial, Video Business Academy by Howard Lynch Video Training, Video Business Academy Demo and Interview with Howard Lynch, Video Business Academy Download, Video Business Academy JVzoo, Video Business Academy OTO, Video Business Academy OTO Upgrade Upsell by Howard Lynch, Video Business Academy PRO OTO Upgrade, Video Business Academy PRO Version OTO, Video Business Academy Upsell
json metadata{"tags":["videobusinessacademy","byhowardlynch","review"],"image":["https://img.youtube.com/vi/g1xi1BOcOiA/0.jpg"],"links":["https://www.youtube.com/embed/g1xi1BOcOiA","https://reviewjvzoo.com/video-business-academy-by-howard-lynch-review-discover-the-unique-method-to-generates-2000-to-3190-a-month-while-requiring-only-half-an-hour-of-work-each-day-and-no-upfront-investment-or-expen/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkvideobusinessacademy
permlinkvideo-business-academy-by-howard-lynch-review-video-business-academy-review
titleVideo Business Academy by Howard Lynch Review , Video Business Academy review
Transaction InfoBlock #21994680/Trx e23dc87b8c8e995dccda46dc6a6e179358fc3587
View Raw JSON Data
{
  "block": 21994680,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Video Business Academy is the blueprint of this successful marketing method and works because of 4 very importants points. Video Business Academy has been live for two days now, and customers are RAVING about it. Not only do you get this powerful training that GUARANTEES you make money. Video Business Academy is going STRONG right now, and if you’ve been on the fence about getting this crazy method, then you should seriously take a look at it now.\n\nVideo Business Academy Profits :\n- This is a full system showing you LIVE how using two free websites can add $150+ a day to your pocket from day one\n- This is without a doubt the system I’d use if I had to start over -and was designed with beginners in mind (although everyone can benefit from using it\n- You can start doing it today, without any red tape or initial investment, and everything is taught in 32 bite-sized HD videos\n\nTestimonial :\n<iframe width=\"827\" height=\"465\" src=\"https://www.youtube.com/embed/g1xi1BOcOiA\" frameborder=\"0\" allow=\"autoplay; encrypted-media\" allowfullscreen></iframe>\n\nCheck More here :\nhttps://reviewjvzoo.com/video-business-academy-by-howard-lynch-review-discover-the-unique-method-to-generates-2000-to-3190-a-month-while-requiring-only-half-an-hour-of-work-each-day-and-no-upfront-investment-or-expen/\n\nTags : Video Business Academy, Video Business Academy Bonus and Download by Howard Lynch, Video Business Academy by Howard Lynch Download, Video Business Academy by Howard Lynch JVzoo, Video Business Academy by Howard Lynch OTO Upsell, Video Business Academy by Howard Lynch Review, Video Business Academy by Howard Lynch Review Pro Bonus and Download, Video Business Academy by Howard Lynch Tutorial, Video Business Academy by Howard Lynch Video Training, Video Business Academy Demo and Interview with Howard Lynch, Video Business Academy Download, Video Business Academy JVzoo, Video Business Academy OTO, Video Business Academy OTO Upgrade Upsell by Howard Lynch, Video Business Academy PRO OTO Upgrade, Video Business Academy PRO Version OTO, Video Business Academy Upsell",
      "json_metadata": "{\"tags\":[\"videobusinessacademy\",\"byhowardlynch\",\"review\"],\"image\":[\"https://img.youtube.com/vi/g1xi1BOcOiA/0.jpg\"],\"links\":[\"https://www.youtube.com/embed/g1xi1BOcOiA\",\"https://reviewjvzoo.com/video-business-academy-by-howard-lynch-review-discover-the-unique-method-to-generates-2000-to-3190-a-month-while-requiring-only-half-an-hour-of-work-each-day-and-no-upfront-investment-or-expen/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "videobusinessacademy",
      "permlink": "video-business-academy-by-howard-lynch-review-video-business-academy-review",
      "title": "Video Business Academy by Howard Lynch Review , Video Business Academy review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T15:33:51",
  "trx_id": "e23dc87b8c8e995dccda46dc6a6e179358fc3587",
  "trx_in_block": 38,
  "virtual_op": 0
}
2018/04/29 14:15:57
authorgurureviewer
permlinkviddictive-2-0-by-mario-brown-review-viddictive-2-0-review
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21993122/Trx 5966f743c494e3e0df7e432cfaeaa2223b585b4b
View Raw JSON Data
{
  "block": 21993122,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "viddictive-2-0-by-mario-brown-review-viddictive-2-0-review",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T14:15:57",
  "trx_id": "5966f743c494e3e0df7e432cfaeaa2223b585b4b",
  "trx_in_block": 48,
  "virtual_op": 0
}
2018/04/29 14:15:27
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkviddictive-2-0-by-mario-brown-review-viddictive-2-0-review
permlinkcheetah-re-gurureviewerviddictive-2-0-by-mario-brown-review-viddictive-2-0-review
title
Transaction InfoBlock #21993112/Trx 1d9307259288cf15058ac9c2d0fd132e3b6af7a8
View Raw JSON Data
{
  "block": 21993112,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "viddictive-2-0-by-mario-brown-review-viddictive-2-0-review",
      "permlink": "cheetah-re-gurureviewerviddictive-2-0-by-mario-brown-review-viddictive-2-0-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T14:15:27",
  "trx_id": "1d9307259288cf15058ac9c2d0fd132e3b6af7a8",
  "trx_in_block": 21,
  "virtual_op": 0
}
2018/04/29 14:15:24
authorgurureviewer
permlinkviddictive-2-0-by-mario-brown-review-viddictive-2-0-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21993111/Trx 3300211c86d7bb863c1c4daa7dad61b7d52781b8
View Raw JSON Data
{
  "block": 21993111,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "viddictive-2-0-by-mario-brown-review-viddictive-2-0-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T14:15:24",
  "trx_id": "3300211c86d7bb863c1c4daa7dad61b7d52781b8",
  "trx_in_block": 4,
  "virtual_op": 0
}
2018/04/29 14:15:15
authorgurureviewer
bodyViddictive 2.0 Personal License Is the world’s first completely automated suite for Facebook video advertising. Viddictive 2.0 helps you to run the most advanced Facebook video ads in a few clicks. It starts with choosing high converting ad templates built from marketers with the ability to upload it directly for Facebook ads following easy steps. Our application is hand-holding every newbie or advanced marketer to create, build and run their especially on autopilot with the easiest way in less time than ever. We understand our customer’s needs because we were in the same position. Facebook advertising required a minimum experience and could be hard especially for a newbie to start with so this is why we decided to develop a solution that we ourselves would enjoy using and sharing it with others. Watch vide demo below : <iframe width="600" height="340" src="https://www.youtube.com/embed/2pP0GeUXv_M" frameborder="0" allow="autoplay; encrypted-media" allowfullscreen></iframe> Viddictive 2.0 Personal License Features: - Super Fast & Cloud Based Solution (Nothing To Install, Access Anywhere) - Over 80 Ready-Make Fully Customizable Animated Video Templates - Over 250 Engaging & Professional Background Tracks For You To Choose From - Customize Every Template – Add Your Image, Add Your Text, Add Your Call To Action - 100% Facebook Integrated – Create Video Ads Directly Inside The Dashboard For Traffic - 100% Mobile Responsive – Video Templates Look STUNNING On Mobile Devices As Well - Video Ad scheduler – Schedule campaigns to run a certain time of day and/or week. - Omni Presence – Use These Videos For Facebook, Instagram, Youtube, Twitter, Shopify - Freelancing Opportunity – Offer Animated Videos To Clients & Prospects - Image Library – Use Any Image Inside Our Image Library - Upload Your Image – You Can Upload Any Image You Like For Your Videos - FAST Render – Export Each Video In Minutes And much more.. Check it out https://reviewjvzoo.com/viddictive-2-0-by-mario-brown-review-finally-revealed-the-worlds-first-fully-automated-100-facebook-integrated-video-ads-platform-for-ecommerce-fb-video-ads-instagram-ads/ Tags : Viddictive 2.0 Personal License, Viddictive 2.0 Personal License Bonus and Download by Mario Brown, Viddictive 2.0 Personal License by Mario Brown Download, Viddictive 2.0 Personal License by Mario Brown JVzoo, Viddictive 2.0 Personal License by Mario Brown OTO Upsell, Viddictive 2.0 Personal License by Mario Brown Review, Viddictive 2.0 Personal License by Mario Brown Review Pro Bonus and Download, Viddictive 2.0 Personal License by Mario Brown Tutorial, Viddictive 2.0 Personal License by Mario Brown Video Training, Viddictive 2.0 Personal License Demo and Interview with Mario Brown, Viddictive 2.0 Personal License Download, Viddictive 2.0 Personal License JVzoo, Viddictive 2.0 Personal License OTO, Viddictive 2.0 Personal License OTO Upgrade Upsell by Mario Brown, Viddictive 2.0 Personal License PRO OTO Upgrade, Viddictive 2.0 Personal License PRO Version OTO, Viddictive 2.0 Personal License Upsell
json metadata{"tags":["viddictive2","bymariobrown","review","viddictive2review"],"image":["https://img.youtube.com/vi/2pP0GeUXv_M/0.jpg"],"links":["https://www.youtube.com/embed/2pP0GeUXv_M","https://reviewjvzoo.com/viddictive-2-0-by-mario-brown-review-finally-revealed-the-worlds-first-fully-automated-100-facebook-integrated-video-ads-platform-for-ecommerce-fb-video-ads-instagram-ads/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkviddictive2
permlinkviddictive-2-0-by-mario-brown-review-viddictive-2-0-review
titleViddictive 2.0 By Mario Brown Review , Viddictive 2.0 Review
Transaction InfoBlock #21993108/Trx 5bb7b00e3bc3e0192821e9c33005602c0eb2a1d1
View Raw JSON Data
{
  "block": 21993108,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Viddictive 2.0 Personal License Is the world’s first completely automated suite for Facebook video advertising. Viddictive 2.0 helps you to run the most advanced Facebook video ads in a few clicks. It starts with choosing high converting ad templates built from marketers with the ability to upload it directly for Facebook ads following easy steps. Our application is hand-holding every newbie or advanced marketer to create, build and run their especially on autopilot with the easiest way in less time than ever. We understand our customer’s needs because we were in the same position. Facebook advertising required a minimum experience and could be hard especially for a newbie to start with so this is why we decided to develop a solution that we ourselves would enjoy using and sharing it with others.\n\nWatch vide demo below :\n<iframe width=\"600\" height=\"340\" src=\"https://www.youtube.com/embed/2pP0GeUXv_M\" frameborder=\"0\" allow=\"autoplay; encrypted-media\" allowfullscreen></iframe>\n\nViddictive 2.0 Personal License Features:\n- Super Fast & Cloud Based Solution (Nothing To Install, Access Anywhere)\n- Over 80 Ready-Make Fully Customizable Animated Video Templates\n- Over 250 Engaging & Professional Background Tracks For You To Choose From\n- Customize Every Template – Add Your Image, Add Your Text, Add Your Call To Action\n- 100% Facebook Integrated – Create Video Ads Directly Inside The Dashboard For Traffic\n- 100% Mobile Responsive – Video Templates Look STUNNING On Mobile Devices As Well\n- Video Ad scheduler – Schedule campaigns to run a certain time of day and/or week.\n- Omni Presence – Use These Videos For Facebook, Instagram, Youtube, Twitter, Shopify\n- Freelancing Opportunity – Offer Animated Videos To Clients & Prospects\n- Image Library – Use Any Image Inside Our Image Library\n- Upload Your Image – You Can Upload Any Image You Like For Your Videos\n- FAST Render – Export Each Video In Minutes\n\nAnd much more..\n\nCheck it out\nhttps://reviewjvzoo.com/viddictive-2-0-by-mario-brown-review-finally-revealed-the-worlds-first-fully-automated-100-facebook-integrated-video-ads-platform-for-ecommerce-fb-video-ads-instagram-ads/\n\nTags : Viddictive 2.0 Personal License, Viddictive 2.0 Personal License Bonus and Download by Mario Brown, Viddictive 2.0 Personal License by Mario Brown Download, Viddictive 2.0 Personal License by Mario Brown JVzoo, Viddictive 2.0 Personal License by Mario Brown OTO Upsell, Viddictive 2.0 Personal License by Mario Brown Review, Viddictive 2.0 Personal License by Mario Brown Review Pro Bonus and Download, Viddictive 2.0 Personal License by Mario Brown Tutorial, Viddictive 2.0 Personal License by Mario Brown Video Training, Viddictive 2.0 Personal License Demo and Interview with Mario Brown, Viddictive 2.0 Personal License Download, Viddictive 2.0 Personal License JVzoo, Viddictive 2.0 Personal License OTO, Viddictive 2.0 Personal License OTO Upgrade Upsell by Mario Brown, Viddictive 2.0 Personal License PRO OTO Upgrade, Viddictive 2.0 Personal License PRO Version OTO, Viddictive 2.0 Personal License Upsell",
      "json_metadata": "{\"tags\":[\"viddictive2\",\"bymariobrown\",\"review\",\"viddictive2review\"],\"image\":[\"https://img.youtube.com/vi/2pP0GeUXv_M/0.jpg\"],\"links\":[\"https://www.youtube.com/embed/2pP0GeUXv_M\",\"https://reviewjvzoo.com/viddictive-2-0-by-mario-brown-review-finally-revealed-the-worlds-first-fully-automated-100-facebook-integrated-video-ads-platform-for-ecommerce-fb-video-ads-instagram-ads/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "viddictive2",
      "permlink": "viddictive-2-0-by-mario-brown-review-viddictive-2-0-review",
      "title": "Viddictive 2.0 By Mario Brown Review , Viddictive 2.0 Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-29T14:15:15",
  "trx_id": "5bb7b00e3bc3e0192821e9c33005602c0eb2a1d1",
  "trx_in_block": 21,
  "virtual_op": 0
}
2018/04/28 23:31:03
authorgurureviewer
permlinkone-on-one-coaching-domain-name-flipping-review-by-lance-groom
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21975428/Trx d9911c558af19946b6e999156cb7495353ab3b02
View Raw JSON Data
{
  "block": 21975428,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "one-on-one-coaching-domain-name-flipping-review-by-lance-groom",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T23:31:03",
  "trx_id": "d9911c558af19946b6e999156cb7495353ab3b02",
  "trx_in_block": 19,
  "virtual_op": 0
}
2018/04/28 23:30:54
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkone-on-one-coaching-domain-name-flipping-review-by-lance-groom
permlinkcheetah-re-gurureviewerone-on-one-coaching-domain-name-flipping-review-by-lance-groom
title
Transaction InfoBlock #21975425/Trx df2a3e2c0d247c06e0be3469932d1d59db514045
View Raw JSON Data
{
  "block": 21975425,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "one-on-one-coaching-domain-name-flipping-review-by-lance-groom",
      "permlink": "cheetah-re-gurureviewerone-on-one-coaching-domain-name-flipping-review-by-lance-groom",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T23:30:54",
  "trx_id": "df2a3e2c0d247c06e0be3469932d1d59db514045",
  "trx_in_block": 18,
  "virtual_op": 0
}
2018/04/28 23:30:51
authorgurureviewer
permlinkone-on-one-coaching-domain-name-flipping-review-by-lance-groom
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21975424/Trx 5e0f914e39bfecc34e3e1528a3e814bab54242d7
View Raw JSON Data
{
  "block": 21975424,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "one-on-one-coaching-domain-name-flipping-review-by-lance-groom",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T23:30:51",
  "trx_id": "5e0f914e39bfecc34e3e1528a3e814bab54242d7",
  "trx_in_block": 11,
  "virtual_op": 0
}
2018/04/28 23:30:39
authorgurureviewer
bodyHi,. I Thought Lance Groom's 1 On 1 Domain Coaching is very high quality . He ‘teaches you step by step EXACTLY what To do . He doesn't leave if out any details. He ‘tells you where ‘to go and even gives you ‘the exact ideas on how To find domains ‘to helpyou make a great flip. He will walk you ‘through finding a domain, how To make ‘the sale, and how To collect paymenf . Plus, he will ‘reach you how ‘to ‘reach '|'his same method To others To increase your payout Excellent program with one of The best coaches you can ‘Find who is doing ‘this. Watch Video Below : <iframe width="853" height="480" src="https://www.youtube.com/embed/H7OHJOsiWiA" frameborder="0" allow="autoplay; encrypted-media" allowfullscreen></iframe> Check more here : https://reviewjvzoo.com/one-on-one-coaching-domain-name-flipping-review-huge-bonus/ Tags : Tags : Demo One on One Coaching - Domain Name Flipping , Demo One on One Coaching - Domain Name Flipping review, Demo One on One Coaching - Domain Name Flipping by lance groom review, One on One Coaching - Domain Name Flipping by lance groom, One on One Coaching - Domain Name Flipping by lance groom- Should you Buy It?, One on One Coaching - Domain Name Flipping by lance groom- The best prices, One on One Coaching - Domain Name Flipping by lance groomA Quick Peek Inside, One on One Coaching - Domain Name Flipping by lance groomBonus, One on One Coaching - Domain Name Flipping by lance groomBonuses, One on One Coaching - Domain Name Flipping by lance groomBuy, One on One Coaching - Domain Name Flipping by lance groomDiscount And Massive Bonus, One on One Coaching - Domain Name Flipping by lance groomHonest Review, One on One Coaching - Domain Name Flipping by lance groomHow to Buy?, One on One Coaching - Domain Name Flipping by lance groomIs It Worth It?, One on One Coaching - Domain Name Flipping by lance groomMega Bonus, One on One Coaching - Domain Name Flipping by lance groomReview, One on One Coaching - Domain Name Flipping by lance groomReview And Bonus Buy Here, One on One Coaching - Domain Name Flipping by lance groomReview And Bonus Buy With Confidence, One on One Coaching - Domain Name Flipping by lance groomReview And Bonus Do I Really Need it, One on One Coaching - Domain Name Flipping by lance groomShould I buy it?, One on One Coaching - Domain Name Flipping by lance groomWho is thisfor?, One on One Coaching - Domain Name Flipping by lance groom OTO1, One on One Coaching - Domain Name Flipping by lance groom OTO2, review One on One Coaching - Domain Name Flipping by lance groom
json metadata{"tags":["oneononecoaching","domainnameflipping","review"],"image":["https://img.youtube.com/vi/H7OHJOsiWiA/0.jpg"],"links":["https://www.youtube.com/embed/H7OHJOsiWiA","https://reviewjvzoo.com/one-on-one-coaching-domain-name-flipping-review-huge-bonus/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkoneononecoaching
permlinkone-on-one-coaching-domain-name-flipping-review-by-lance-groom
titleOne on One Coaching - Domain Name Flipping Review , by lance groom
Transaction InfoBlock #21975420/Trx c6e6099bf5de402c0725ef6474e08467af6face6
View Raw JSON Data
{
  "block": 21975420,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Hi,.  I Thought Lance Groom's 1 On 1 Domain Coaching is very high quality . He ‘teaches you step by step EXACTLY what To do . He doesn't leave if out any details. He ‘tells you where ‘to go and even gives you ‘the exact ideas on how To find domains ‘to helpyou make a great flip. He will walk you ‘through finding a domain, how To make ‘the sale, and how To collect paymenf . Plus, he will ‘reach you how ‘to ‘reach '|'his same method To others To increase your payout Excellent program with one of The best coaches you can ‘Find who is doing ‘this.\n\nWatch Video Below :\n\n<iframe width=\"853\" height=\"480\" src=\"https://www.youtube.com/embed/H7OHJOsiWiA\" frameborder=\"0\" allow=\"autoplay; encrypted-media\" allowfullscreen></iframe>\n\nCheck more here :\nhttps://reviewjvzoo.com/one-on-one-coaching-domain-name-flipping-review-huge-bonus/\n\nTags : Tags : Demo One on One Coaching - Domain Name Flipping , Demo One on One Coaching - Domain Name Flipping  review, Demo One on One Coaching - Domain Name Flipping by lance groom review, One on One Coaching - Domain Name Flipping by lance groom, One on One Coaching - Domain Name Flipping by lance groom- Should you Buy It?, One on One Coaching - Domain Name Flipping by lance groom- The best prices, One on One Coaching - Domain Name Flipping by lance groomA Quick Peek Inside, One on One Coaching - Domain Name Flipping by lance groomBonus, One on One Coaching - Domain Name Flipping by lance groomBonuses, One on One Coaching - Domain Name Flipping by lance groomBuy, One on One Coaching - Domain Name Flipping by lance groomDiscount And Massive Bonus, One on One Coaching - Domain Name Flipping by lance groomHonest Review, One on One Coaching - Domain Name Flipping by lance groomHow to Buy?, One on One Coaching - Domain Name Flipping by lance groomIs It Worth It?, One on One Coaching - Domain Name Flipping by lance groomMega Bonus, One on One Coaching - Domain Name Flipping by lance groomReview, One on One Coaching - Domain Name Flipping by lance groomReview And Bonus Buy Here, One on One Coaching - Domain Name Flipping by lance groomReview And Bonus Buy With Confidence, One on One Coaching - Domain Name Flipping by lance groomReview And Bonus Do I Really Need it, One on One Coaching - Domain Name Flipping by lance groomShould I buy it?, One on One Coaching - Domain Name Flipping by lance groomWho is thisfor?, One on One Coaching - Domain Name Flipping by lance groom OTO1, One on One Coaching - Domain Name Flipping by lance groom OTO2, review One on One Coaching - Domain Name Flipping by lance groom",
      "json_metadata": "{\"tags\":[\"oneononecoaching\",\"domainnameflipping\",\"review\"],\"image\":[\"https://img.youtube.com/vi/H7OHJOsiWiA/0.jpg\"],\"links\":[\"https://www.youtube.com/embed/H7OHJOsiWiA\",\"https://reviewjvzoo.com/one-on-one-coaching-domain-name-flipping-review-huge-bonus/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "oneononecoaching",
      "permlink": "one-on-one-coaching-domain-name-flipping-review-by-lance-groom",
      "title": "One on One Coaching - Domain Name Flipping Review , by lance groom"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T23:30:39",
  "trx_id": "c6e6099bf5de402c0725ef6474e08467af6face6",
  "trx_in_block": 45,
  "virtual_op": 0
}
2018/04/28 23:21:54
authorgurureviewer
permlinktraffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21975245/Trx b0e9b1f98bd7b43afa7685520740da58a32d3431
View Raw JSON Data
{
  "block": 21975245,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "traffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T23:21:54",
  "trx_id": "b0e9b1f98bd7b43afa7685520740da58a32d3431",
  "trx_in_block": 16,
  "virtual_op": 0
}
2018/04/28 22:33:18
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinktraffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review
permlinkcheetah-re-gurureviewertraffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review
title
Transaction InfoBlock #21974273/Trx ef76cbce6a35ea902171a892b787320218d4502e
View Raw JSON Data
{
  "block": 21974273,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "traffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review",
      "permlink": "cheetah-re-gurureviewertraffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T22:33:18",
  "trx_id": "ef76cbce6a35ea902171a892b787320218d4502e",
  "trx_in_block": 32,
  "virtual_op": 0
}
2018/04/28 22:33:15
authorgurureviewer
permlinktraffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21974272/Trx b8f8b3be1b56e1991f31d80fe9fdfde3ebfb9128
View Raw JSON Data
{
  "block": 21974272,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "traffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T22:33:15",
  "trx_id": "b8f8b3be1b56e1991f31d80fe9fdfde3ebfb9128",
  "trx_in_block": 27,
  "virtual_op": 0
}
2018/04/28 22:33:09
authorgurureviewer
bodyImagine being able to upload the same video to YouTube and start generating traffic MINUTES later – on complete autopilot. (how many hours of time would you save?). Interesting? Well, today this concept actually became a reality – the Traffic Trigger software just went live! With this clever piece of software, you’ll be able to submit THE SAME video to YouTube and other video sites multiple times & rank it in minutes! (it spins the file itself). This means that you’ll be able to save a TON of time and start getting traffic almost instantly – on complete autopilot. Traffic Trigger 2.0 is the first software that lets you get unlimited free SEO traffic without ANY SEO knowledge needed… by getting you first page Google & Youtube rankings with ease! Have Traffic Trigger 2.0 go to work for you today and start getting you the free, scalable passive traffic you need in any niche you want… You can finally feel like you can get traffic “on demand” in any and all niches… something every marketer wish they had! In a nutshell, this is a simple system + software for getting you all the FREE traffic you could ever want! CHeck here : https://reviewjvzoo.com/traffic-trigger-2-0-by-art-flair-review-discover-a-simple-software-video-training-case-studies-dfy-pack-designed-for-getting-you-all-the-free-traffic-you-could-ever-want/ Tags : Traffic Trigger by Art Flair, Alex Krulik and Ray Lane review, Traffic Trigger by Art Flair, Alex Krulik and Ray Lane, Buy Traffic Trigger, Get Traffic Trigger Software And Training by Art Flair, How to Get Free Traffic, OTO #1 - Traffic Trigger 2.0 Pro Upgrade OTO, OTO #2 - Traffic Trigger 2.0 Link Building Module OTO, OTO #3 - Traffic Trigger 2.0 DFY Videos Upgrade OTO, OTO #4 - Traffic Trigger 2.0 3x Software Bundle, Traffic Trigger by Art Flair Review, Traffic Trigger Coupon Code, Traffic Trigger Discount, Traffic Trigger Lite Review, Traffic Trigger Pro Review, Traffic Trigger Review, Traffic Trigger Software And Training by Art Flair, Traffic Trigger Software And Training by Art Flair Bonus, Traffic Trigger Software And Training by Art Flair Demo Software, Traffic Trigger Software And Training by Art Flair Download, Traffic Trigger Software And Training by Art Flair Jvzoo, Traffic Trigger Software And Training by Art Flair OTO Upsell, Traffic Trigger Software And Training by Art Flair Review, Traffic Trigger Software And Training by Art Flair Video Training, Traffic Trigger Software And Training by Art Flair Warriorforum, Traffic Trigger Software And Training by Art Flair WSO, What is Traffic Trigger Software And Training by Art Flair
json metadata{"tags":["traffictrigger2","byartflair","review","traffictrigger2review"],"links":["https://reviewjvzoo.com/traffic-trigger-2-0-by-art-flair-review-discover-a-simple-software-video-training-case-studies-dfy-pack-designed-for-getting-you-all-the-free-traffic-you-could-ever-want/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinktraffictrigger2
permlinktraffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review
titletraffictrigger 2.0 byartflair review , traffic trigger 2.0 review
Transaction InfoBlock #21974270/Trx 54459c8d79d3c014753f6ba02c6cab19f17286a3
View Raw JSON Data
{
  "block": 21974270,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Imagine being able to upload the same video to YouTube and start generating traffic MINUTES later – on complete autopilot. (how many hours of time would you save?). Interesting? Well, today this concept actually became a reality – the Traffic Trigger software just went live! With this clever piece of software, you’ll be able to submit THE SAME video to YouTube and other video sites multiple times & rank it in minutes! (it spins the file itself). This means that you’ll be able to save a TON of time and start getting traffic almost instantly – on complete autopilot.\n\nTraffic Trigger 2.0 is the first software that lets you get unlimited free SEO traffic without ANY SEO knowledge needed… by getting you first page Google & Youtube rankings with ease! Have Traffic Trigger 2.0 go to work for you today and start getting you the free, scalable passive traffic you need in any niche you want… You can finally feel like you can get traffic “on demand” in any and all niches… something every marketer wish they had!\n\nIn a nutshell, this is a simple system + software for getting you all the FREE traffic you could ever want!\n\nCHeck here :\nhttps://reviewjvzoo.com/traffic-trigger-2-0-by-art-flair-review-discover-a-simple-software-video-training-case-studies-dfy-pack-designed-for-getting-you-all-the-free-traffic-you-could-ever-want/\n\nTags : Traffic Trigger by Art Flair, Alex Krulik and Ray Lane review, Traffic Trigger by Art Flair, Alex Krulik and Ray Lane, Buy Traffic Trigger, Get Traffic Trigger Software And Training by Art Flair, How to Get Free Traffic, OTO #1 - Traffic Trigger 2.0 Pro Upgrade OTO, OTO #2 - Traffic Trigger 2.0 Link Building Module OTO, OTO #3 - Traffic Trigger 2.0 DFY Videos Upgrade OTO, OTO #4 - Traffic Trigger 2.0 3x Software Bundle, Traffic Trigger by Art Flair Review, Traffic Trigger Coupon Code, Traffic Trigger Discount, Traffic Trigger Lite Review, Traffic Trigger Pro Review, Traffic Trigger Review, Traffic Trigger Software And Training by Art Flair, Traffic Trigger Software And Training by Art Flair Bonus, Traffic Trigger Software And Training by Art Flair Demo Software, Traffic Trigger Software And Training by Art Flair Download, Traffic Trigger Software And Training by Art Flair Jvzoo, Traffic Trigger Software And Training by Art Flair OTO Upsell, Traffic Trigger Software And Training by Art Flair Review, Traffic Trigger Software And Training by Art Flair Video Training, Traffic Trigger Software And Training by Art Flair Warriorforum, Traffic Trigger Software And Training by Art Flair WSO, What is Traffic Trigger Software And Training by Art Flair",
      "json_metadata": "{\"tags\":[\"traffictrigger2\",\"byartflair\",\"review\",\"traffictrigger2review\"],\"links\":[\"https://reviewjvzoo.com/traffic-trigger-2-0-by-art-flair-review-discover-a-simple-software-video-training-case-studies-dfy-pack-designed-for-getting-you-all-the-free-traffic-you-could-ever-want/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "traffictrigger2",
      "permlink": "traffictrigger-2-0-byartflair-review-traffic-trigger-2-0-review",
      "title": "traffictrigger 2.0 byartflair review , traffic trigger 2.0 review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T22:33:09",
  "trx_id": "54459c8d79d3c014753f6ba02c6cab19f17286a3",
  "trx_in_block": 15,
  "virtual_op": 0
}
2018/04/28 10:35:24
authorgurureviewer
permlinkdfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21959917/Trx 605a499515c1d419187cdb00e1c46e7b35f2c1ff
View Raw JSON Data
{
  "block": 21959917,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "dfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T10:35:24",
  "trx_id": "605a499515c1d419187cdb00e1c46e7b35f2c1ff",
  "trx_in_block": 3,
  "virtual_op": 0
}
2018/04/28 10:31:39
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkdfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview
permlinkcheetah-re-gurureviewerdfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview
title
Transaction InfoBlock #21959842/Trx f5bf1aa31cee2d21fe94eaf1e5b5b96e6d212e11
View Raw JSON Data
{
  "block": 21959842,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "dfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview",
      "permlink": "cheetah-re-gurureviewerdfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T10:31:39",
  "trx_id": "f5bf1aa31cee2d21fe94eaf1e5b5b96e6d212e11",
  "trx_in_block": 35,
  "virtual_op": 0
}
2018/04/28 10:31:15
authorgurureviewer
bodyDFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers is The Best software will automatically create FIVE stunning Amazon comparison sites in the red hot kitchen appliances niche. Barry Rodgers & Val Wilson are releasing something to make it INCREDIBLY easy to cash in on Amazon. They have created something to make it incredibly easy for anyone to have your own niche comparison sites in a matter of minutes. They selected a popular sub niche on one of the biggest and most profitable affiliate platforms, Amazon.com – the sub niche we have chosen is Kitchen Equipment. Easy Comparison Sites Kitchen Equipment DFY Affiliate a niche where consumers are constantly spending money, for both new kitchen equipment and replacement goods. They have researched the best selling, most popular products in this sub niche, and drilled this down to 5 products. You get 5 DFY beautiful Amazon Product Comparison sites in the massive Kitchen Equipment niche. And with their custom made software, you can add your Amazon affiliate links to these sites and have them up and running in just a few clicks. This is a great product that will make your parth toi earning Amazomn affiliate commissions SO much easier – in fact it just doesn’t get easier than this! And if you are quick, you get ALL FIVE sites (and bonus traffic training) for just one dollar each. They have set this up in a web based software so that you can add your details and affiliate links in just a few clicks. No code editing is required! Download the files it creates, upload to your server and you have 5 of your own niche comparison sites, reviewing top selling, high ticket products, all with positive real customer feedback, all with your own personalised privacy policy and YOUR affiliate links. Amazon affiliate marketing is one of the easiest ways to start making money online right away. The site itself is obviously extremely popular, with very high consumer trust, and it and sells almost everything under the sun. And as an Amazon affiliate, you will not just earn commissions on your direct affiliate links. When customers add other products to their shopping basket, you will get commission on these too. Our Easy Comparison Sites Kitchen Essentials Pack does all this for you..,and MUCH more. We did the research, created reviews, created a professional showcasing video for each product and put it all together on FIVE stunning mobile responsive comparison sites. This is a fantastic opportunity to get 5 beautiful Niche Comparison Sites, all set up in a web based software that makes personalizing them to you SO easy, it’s incredible…at a fraction of the price you really should be paying. Don’t miss this opportunity. Jump on board now before the price rises. Chekc more here : https://reviewjvzoo.com/dfy-affiliate-comparison-sites-kitchen-essentials-pack-1-by-barry-rodgers-review-this-software-will-automatically-create-five-stunning-amazon-comparison-sites-in-the-red-hot-kitchen-appliances-nic/ Tags : DFY Affiliate Comparison Sites - Kitchen Essentials Pack 1 By Barry Rodgers Review, Kitchen Essentials Pack 1 By Barry Rodgers Review, Kitchen Essentials Pack 1 Review, Buy DFY Affiliate Comparison Sites, Buy DFY Affiliate Comparison Sites by barryrodgers, Buy DFY Affiliate Comparison Sites Kitchen Equipment, Buy DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers, DFY Affiliate Comparison Sites, DFY Affiliate Comparison Sites Bonus, DFY Affiliate Comparison Sites by barryrodgers, DFY Affiliate Comparison Sites by barryrodgers Bonus, DFY Affiliate Comparison Sites by barryrodgers Download, DFY Affiliate Comparison Sites by barryrodgers Review, DFY Affiliate Comparison Sites by barryrodgers Software, DFY Affiliate Comparison Sites by barryrodgers Video, DFY Affiliate Comparison Sites Download, DFY Affiliate Comparison Sites Kitchen Equipment, DFY Affiliate Comparison Sites Kitchen Equipment Bonus, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Bonus, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Download, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Review, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Software, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Video, DFY Affiliate Comparison Sites Kitchen Equipment Download, DFY Affiliate Comparison Sites Kitchen Equipment Review, DFY Affiliate Comparison Sites Kitchen Equipment Software, DFY Affiliate Comparison Sites Kitchen Equipment Video, DFY Affiliate Comparison Sites Review, DFY Affiliate Comparison Sites Software, DFY Affiliate Comparison Sites Video
json metadata{"tags":["dfyaffiliate","comparisonsites","kitchenessentialspack1","bybarryrodgersreview"],"links":["https://reviewjvzoo.com/dfy-affiliate-comparison-sites-kitchen-essentials-pack-1-by-barry-rodgers-review-this-software-will-automatically-create-five-stunning-amazon-comparison-sites-in-the-red-hot-kitchen-appliances-nic/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkdfyaffiliate
permlinkdfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview
titledfyaffiliate comparisonsites kitchenessentialspack1 bybarryrodgersreview
Transaction InfoBlock #21959834/Trx f4ac365ab3ef0b4b5d8a86143fbdfacc1f5384eb
View Raw JSON Data
{
  "block": 21959834,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers is The Best software will automatically create FIVE stunning Amazon comparison sites in the red hot kitchen appliances niche. Barry Rodgers & Val Wilson are releasing something to make it INCREDIBLY easy to cash in on Amazon. They have created something to make it incredibly easy for anyone to have your own niche comparison sites in a matter of minutes. They selected a popular sub niche on one of the biggest and most profitable affiliate platforms, Amazon.com – the sub niche we have chosen is Kitchen Equipment. Easy Comparison Sites Kitchen Equipment DFY Affiliate a niche where consumers are constantly spending money, for both new kitchen equipment and replacement goods. They have researched the best selling, most popular products in this sub niche, and drilled this down to 5 products. You get 5 DFY beautiful Amazon Product Comparison sites in the massive Kitchen Equipment niche. And with their custom made software, you can add your Amazon affiliate links to these sites and have them up and running in just a few clicks. This is a great product that will make your parth toi earning Amazomn affiliate commissions SO much easier – in fact it just doesn’t get easier than this! And if you are quick, you get ALL FIVE sites (and bonus traffic training) for just one dollar each. They have set this up in a web based software so that you can add your details and affiliate links in just a few clicks. No code editing is required! Download the files it creates, upload to your server and you have 5 of your own niche comparison sites, reviewing top selling, high ticket products, all with positive real customer feedback, all with your own personalised privacy policy and YOUR affiliate links.\n\nAmazon affiliate marketing is one of the easiest ways to start making money online right away. The site itself is obviously extremely popular, with very high consumer trust, and it and sells almost everything under the sun. And as an Amazon affiliate, you will not just earn commissions on your direct affiliate links. When customers add other products to their shopping basket, you will get commission on these too. Our Easy Comparison Sites Kitchen Essentials Pack does all this for you..,and MUCH more. We did the research, created reviews, created a professional showcasing video for each product and put it all together on FIVE stunning mobile responsive comparison sites. This is a fantastic opportunity to get 5 beautiful Niche Comparison Sites, all set up in a web based software that makes personalizing them to you SO easy, it’s incredible…at a fraction of the price you really should be paying. Don’t miss this opportunity. Jump on board now before the price rises.\n\nChekc more here :\nhttps://reviewjvzoo.com/dfy-affiliate-comparison-sites-kitchen-essentials-pack-1-by-barry-rodgers-review-this-software-will-automatically-create-five-stunning-amazon-comparison-sites-in-the-red-hot-kitchen-appliances-nic/\n\nTags :  DFY Affiliate Comparison Sites - Kitchen Essentials Pack 1 By Barry Rodgers Review, Kitchen Essentials Pack 1 By Barry Rodgers Review, Kitchen Essentials Pack 1 Review, Buy DFY Affiliate Comparison Sites, Buy DFY Affiliate Comparison Sites by barryrodgers, Buy DFY Affiliate Comparison Sites Kitchen Equipment, Buy DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers, DFY Affiliate Comparison Sites, DFY Affiliate Comparison Sites Bonus, DFY Affiliate Comparison Sites by barryrodgers, DFY Affiliate Comparison Sites by barryrodgers Bonus, DFY Affiliate Comparison Sites by barryrodgers Download, DFY Affiliate Comparison Sites by barryrodgers Review, DFY Affiliate Comparison Sites by barryrodgers Software, DFY Affiliate Comparison Sites by barryrodgers Video, DFY Affiliate Comparison Sites Download, DFY Affiliate Comparison Sites Kitchen Equipment, DFY Affiliate Comparison Sites Kitchen Equipment Bonus, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Bonus, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Download, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Review, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Software, DFY Affiliate Comparison Sites Kitchen Equipment by barryrodgers Video, DFY Affiliate Comparison Sites Kitchen Equipment Download, DFY Affiliate Comparison Sites Kitchen Equipment Review, DFY Affiliate Comparison Sites Kitchen Equipment Software, DFY Affiliate Comparison Sites Kitchen Equipment Video, DFY Affiliate Comparison Sites Review, DFY Affiliate Comparison Sites Software, DFY Affiliate Comparison Sites Video",
      "json_metadata": "{\"tags\":[\"dfyaffiliate\",\"comparisonsites\",\"kitchenessentialspack1\",\"bybarryrodgersreview\"],\"links\":[\"https://reviewjvzoo.com/dfy-affiliate-comparison-sites-kitchen-essentials-pack-1-by-barry-rodgers-review-this-software-will-automatically-create-five-stunning-amazon-comparison-sites-in-the-red-hot-kitchen-appliances-nic/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "dfyaffiliate",
      "permlink": "dfyaffiliate-comparisonsites-kitchenessentialspack1-bybarryrodgersreview",
      "title": "dfyaffiliate comparisonsites kitchenessentialspack1 bybarryrodgersreview"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T10:31:15",
  "trx_id": "f4ac365ab3ef0b4b5d8a86143fbdfacc1f5384eb",
  "trx_in_block": 0,
  "virtual_op": 0
}
2018/04/28 09:40:57
authorgurureviewer
permlinkpublic-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21958828/Trx 4e00913831cf3ef9aca35e8daf2d84434fdfeb0d
View Raw JSON Data
{
  "block": 21958828,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "public-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T09:40:57",
  "trx_id": "4e00913831cf3ef9aca35e8daf2d84434fdfeb0d",
  "trx_in_block": 19,
  "virtual_op": 0
}
2018/04/28 05:52:03
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkpublic-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review
permlinkcheetah-re-gurureviewerpublic-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review
title
Transaction InfoBlock #21954250/Trx 72aa66c68d4e37b89ec2a98ea717af88d469a18d
View Raw JSON Data
{
  "block": 21954250,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "public-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review",
      "permlink": "cheetah-re-gurureviewerpublic-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T05:52:03",
  "trx_id": "72aa66c68d4e37b89ec2a98ea717af88d469a18d",
  "trx_in_block": 36,
  "virtual_op": 0
}
2018/04/28 05:51:18
authorgurureviewer
permlinkpublic-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review
voterthe3brother
weight10000 (100.00%)
Transaction InfoBlock #21954235/Trx f86c1d8a3d10ad7ae38c2c67693d92244f1b9a1c
View Raw JSON Data
{
  "block": 21954235,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "public-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review",
      "voter": "the3brother",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T05:51:18",
  "trx_id": "f86c1d8a3d10ad7ae38c2c67693d92244f1b9a1c",
  "trx_in_block": 27,
  "virtual_op": 0
}
2018/04/28 05:50:42
authorgurureviewer
bodyPublic Domain Finder Images Edition by Alessandro Zamboni is Amazing software that searches the public domain images for you on 42 different websites. A software that with one keyword and one click delivers a document full of links pointing to public domain photo databases you want to check. No more time spent jumping from one site to the next to find the right images! By entering in their desired niche and clicking a button, your customers will be able to search on 42 sources and get the results delivered in a document. This is the real power of our PD Finder: Photos Edition, a technology able to help you forever. You get a document filled with clickable links taking you to photo-sites with the exact photos you are searching for, listed together in one place for you. Imagine the time they can save with this app. Searching on each one of the 42 image sites could take around 3 and a half hours. With our app, it’s just 10 seconds. And they can edit the document, use it themselves or resell it to a third party. Imagine finding the images you are searching for, all usable for private and commercial projects without limitations, on every possible niche. So you can stop spending money for paid photos, but you can also make money by reselling image packages like many others are currently doing. People love photos, images and clip-art, especially if they can get them all together without bouncing from one site to another. This “Public Domain Finder” by Alessandro Zamboni and Dirk Wagner really is a game changer. When I think I was throwing away hours trying to find public domain images, and now with one keyword and one mouse click I can get it all listed in on one document, I feel embarrassed. This software searches for images, photos, clip-arts and drawings in a snap. Go now, before it sells out or the price goes up! This is totally newbie friendly, and in one click you can find thousands of photos, images and clip-arts. Check more here : https://reviewjvzoo.com/public-domain-finder-by-alessandro-zamboni-review-finally-revealed-the-best-software-to-find-public-domain-content-in-10-seconds-and-with-1-click/ Tags : Public Domain Finder review, demo Public Domain Finder by Alessandro Zamboni review, Buy Public Domain Finder, Buy Public Domain Finder by Alessandro Zamboni, Buy Public Domain Finder Images Edition by Alessandro Zamboni, Public Domain Finder, Public Domain Finder Bonus, Public Domain Finder by Alessandro Zamboni, Public Domain Finder by Alessandro Zamboni Bonus, Public Domain Finder by Alessandro Zamboni Download, Public Domain Finder by Alessandro Zamboni Review, Public Domain Finder by Alessandro Zamboni Software, Public Domain Finder by Alessandro Zamboni Video, Public Domain Finder Download, Public Domain Finder Images Edition by Alessandro Zamboni, Public Domain Finder Images Edition by Alessandro Zamboni Bonus, Public Domain Finder Images Edition by Alessandro Zamboni Download, Public Domain Finder Images Edition by Alessandro Zamboni Review, Public Domain Finder Images Edition by Alessandro Zamboni Software, Public Domain Finder Images Edition by Alessandro Zamboni Video, Public Domain Finder Review, Public Domain Finder Software, Public Domain Finder Video
json metadata{"tags":["publicdomainfinder","byalessandrozamboni","review","publicdomainfinderreview"],"links":["https://reviewjvzoo.com/public-domain-finder-by-alessandro-zamboni-review-finally-revealed-the-best-software-to-find-public-domain-content-in-10-seconds-and-with-1-click/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkpublicdomainfinder
permlinkpublic-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review
titlePublic Domain Finder review, Public Domain Finder by Alessandro Zamboni review
Transaction InfoBlock #21954223/Trx 8dbfacaa4cf86de312fdc8fb5e3d7e603e19766c
View Raw JSON Data
{
  "block": 21954223,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Public Domain Finder Images Edition by Alessandro Zamboni is Amazing software that searches the public domain images for you on 42 different websites. A software that with one keyword and one click delivers a document full of links pointing to public domain photo databases you want to check. No more time spent jumping from one site to the next to find the right images! By entering in their desired niche and clicking a button, your customers will be able to search on 42 sources and get the results delivered in a document. This is the real power of our PD Finder: Photos Edition, a technology able to help you forever. You get a document filled with clickable links taking you to photo-sites with the exact photos you are searching for, listed together in one place for you. Imagine the time they can save with this app. Searching on each one of the 42 image sites could take around 3 and a half hours. With our app, it’s just 10 seconds. And they can edit the document, use it themselves or resell it to a third party. Imagine finding the images you are searching for, all usable for private and commercial projects without limitations, on every possible niche. So you can stop spending money for paid photos, but you can also make money by reselling image packages like many others are currently doing. People love photos, images and clip-art, especially if they can get them all together without bouncing from one site to another. This “Public Domain Finder” by Alessandro Zamboni and Dirk Wagner really is a game changer. When I think I was throwing away hours trying to find public domain images, and now with one keyword and one mouse click I can get it all listed in on one document, I feel embarrassed. This software searches for images, photos, clip-arts and drawings in a snap. Go now, before it sells out or the price goes up! This is totally newbie friendly, and in one click you can find thousands of photos, images and clip-arts.\n\nCheck more here :\nhttps://reviewjvzoo.com/public-domain-finder-by-alessandro-zamboni-review-finally-revealed-the-best-software-to-find-public-domain-content-in-10-seconds-and-with-1-click/\n\nTags : Public Domain Finder review, demo Public Domain Finder by Alessandro Zamboni review, Buy Public Domain Finder, Buy Public Domain Finder by Alessandro Zamboni, Buy Public Domain Finder Images Edition by Alessandro Zamboni, Public Domain Finder, Public Domain Finder Bonus, Public Domain Finder by Alessandro Zamboni, Public Domain Finder by Alessandro Zamboni Bonus, Public Domain Finder by Alessandro Zamboni Download, Public Domain Finder by Alessandro Zamboni Review, Public Domain Finder by Alessandro Zamboni Software, Public Domain Finder by Alessandro Zamboni Video, Public Domain Finder Download, Public Domain Finder Images Edition by Alessandro Zamboni, Public Domain Finder Images Edition by Alessandro Zamboni Bonus, Public Domain Finder Images Edition by Alessandro Zamboni Download, Public Domain Finder Images Edition by Alessandro Zamboni Review, Public Domain Finder Images Edition by Alessandro Zamboni Software, Public Domain Finder Images Edition by Alessandro Zamboni Video, Public Domain Finder Review, Public Domain Finder Software, Public Domain Finder Video",
      "json_metadata": "{\"tags\":[\"publicdomainfinder\",\"byalessandrozamboni\",\"review\",\"publicdomainfinderreview\"],\"links\":[\"https://reviewjvzoo.com/public-domain-finder-by-alessandro-zamboni-review-finally-revealed-the-best-software-to-find-public-domain-content-in-10-seconds-and-with-1-click/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "publicdomainfinder",
      "permlink": "public-domain-finder-review-public-domain-finder-by-alessandro-zamboni-review",
      "title": "Public Domain Finder review, Public Domain Finder by Alessandro Zamboni review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T05:50:42",
  "trx_id": "8dbfacaa4cf86de312fdc8fb5e3d7e603e19766c",
  "trx_in_block": 1,
  "virtual_op": 0
}
2018/04/28 05:03:30
authorgurureviewer
permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
voteracknowledgement
weight1000 (10.00%)
Transaction InfoBlock #21953279/Trx db4e41868b06f6d189cb18a05459ae8d63960816
View Raw JSON Data
{
  "block": 21953279,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "voter": "acknowledgement",
      "weight": 1000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T05:03:30",
  "trx_id": "db4e41868b06f6d189cb18a05459ae8d63960816",
  "trx_in_block": 6,
  "virtual_op": 0
}
2018/04/28 04:47:33
authorgurureviewer
permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
votergregory.latinier
weight2000 (20.00%)
Transaction InfoBlock #21952960/Trx 5cd9510f0903e1812c52cd34ab3fa1c6cb81593e
View Raw JSON Data
{
  "block": 21952960,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "voter": "gregory.latinier",
      "weight": 2000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T04:47:33",
  "trx_id": "5cd9510f0903e1812c52cd34ab3fa1c6cb81593e",
  "trx_in_block": 41,
  "virtual_op": 0
}
2018/04/28 04:30:54
authorgurureviewer
permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21952627/Trx 7a512c99f0c9bea6bc5583a727f8fb0c404f9935
View Raw JSON Data
{
  "block": 21952627,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T04:30:54",
  "trx_id": "7a512c99f0c9bea6bc5583a727f8fb0c404f9935",
  "trx_in_block": 25,
  "virtual_op": 0
}
2018/04/28 04:29:18
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
permlinkcheetah-re-gurureviewerbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
title
Transaction InfoBlock #21952595/Trx 4f77b1ab5d69c01a325c2a90dc1180a81a657108
View Raw JSON Data
{
  "block": 21952595,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "permlink": "cheetah-re-gurureviewerbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T04:29:18",
  "trx_id": "4f77b1ab5d69c01a325c2a90dc1180a81a657108",
  "trx_in_block": 18,
  "virtual_op": 0
}
2018/04/28 04:29:12
authorgurureviewer
permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21952593/Trx c233c214cff328aae8190a23d39658db72e5ba4d
View Raw JSON Data
{
  "block": 21952593,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T04:29:12",
  "trx_id": "c233c214cff328aae8190a23d39658db72e5ba4d",
  "trx_in_block": 38,
  "virtual_op": 0
}
2018/04/28 04:29:09
authorgurureviewer
bodyHave you ever wondered how some people are able to get incredible engagement on their Facebook posts and drive loads of free traffic to their offers? I’m not talking about a couple likes and comments here and there. I mean people who get 100-300+ likes and 20-50+ comments on their posts! Yea, THOSE PEOPLE! You know who we’re talking about. Every time they post, people are falling over themselves to leave a comment and interact with that person’s post. Why? Well, it’s a combination of a few things! 1. The content being posted is Great content (most of the time) 2. The people viewing that content are HIGHLY INTERESTED in it. 3. The person posting the content has filled their friends list with ONLY those people! 4. The person posting is CONSTANTLY optimizing their friends list by removing old / un-engaged “friends” and adding fresh prospects who are likely to enjoy AND engage with their posts. That is literally the PERFECT STORM for success on Facebook! That sounds great but my friends list is filled with dead weight who never show my posts any love and it’s a pain in the butt to remove them! Do you need a solution? Let’s check out my Buddy Check Review below! Buddy Check allows you to find out who all the un-engaged / inactive friends are on your friends list and quickly remove them with a couple clicks of the mouse! It’s a web based software that can be accessed from anywhere you have internet service. In other words, This is a tool that allows you to sort through your least engaged friends using several powerful filters AND remove them with a couple clicks of the mouse! But remember…. removing your least engaged friends is just PART of the success formula on Facebook. You also need to fill your friends list with people who are likely to be interested in your posts. Don’t worry, they’ve got you covered! Scroll down for more details! Buddy Check works for selling ANYTHING! It’s just an easier way to get more TARGETED eyeballs looking at your offers on a daily basis! The best part is you don’t need any of the following to start profiting with Buddy Check: - Email List: Using buddy check you can build a targeted audience who you can promote to for free! - Your Own Products: There are thousands of affiliate offers you can promote if you don’t have any of your own products to sell. - Paid Advertisements: No need to spend hundreds or thousands of dollars on Facebook, Instagram, YouTube, or Google Ads! - Experience: It doesn’t matter if you’re a complete newbie or a seasoned marketer. Buddy Check is simple to use and flat out WORKS! Check more here : https://reviewjvzoo.com/buddy-check-by-chris-beatty-review-increase-engagement-rates-on-your-facebook-account-by-quickly-removing-all-the-dead-weight-friends-who-never-interact-with-you-and-add-targeted-prospects-to-yo/ TAgs : Buddy Check by Chris Beatty Review, Demo Buddy Check by Chris Beatty Review, buddy check, buddy check bonus, buddy check bonus review, buddy check chris beatty, buddy check demo, buddy check honest review, buddy check oto, buddy check oto review, buddy check review bonus, buddy check review by users, buddy check review oto, buddy check review upsell, buddy check upsell, buddy check upsell review, buy buddy check, download buddy check, get buddy check, purchase buddy check, Buddy check premium review, Billed one single payment review,
json metadata{"tags":["buddycheck","bychrisbeatty","review","buddycheckreview"],"links":["https://reviewjvzoo.com/buddy-check-by-chris-beatty-review-increase-engagement-rates-on-your-facebook-account-by-quickly-removing-all-the-dead-weight-friends-who-never-interact-with-you-and-add-targeted-prospects-to-yo/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkbuddycheck
permlinkbuddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review
titlebuddycheck bychrisbeatty review , buddycheckreview , Buddy Check by Chris Beatty Review
Transaction InfoBlock #21952592/Trx 0c30e6e9d41496f9570eb5b9117cbf11dfde3386
View Raw JSON Data
{
  "block": 21952592,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Have you ever wondered how some people are able to get incredible engagement on their Facebook posts and drive loads of free traffic to their offers? I’m not talking about a couple likes and comments here and there. I mean people who get 100-300+ likes and 20-50+ comments on their posts! Yea, THOSE PEOPLE! You know who we’re talking about.\n\nEvery time they post, people are falling over themselves to leave a comment and interact with that person’s post. Why? Well, it’s a combination of a few things!\n\n1. The content being posted is Great content (most of the time)\n2. The people viewing that content are HIGHLY INTERESTED in it.\n3. The person posting the content has filled their friends list with ONLY those people!\n4. The person posting is CONSTANTLY optimizing their friends list by removing old / un-engaged “friends” and adding fresh prospects who are likely to enjoy AND engage with their posts.\nThat is literally the PERFECT STORM for success on Facebook! That sounds great but my friends list is filled with dead weight who never show my posts any love and it’s a pain in the butt to remove them! Do you need a solution? Let’s check out my Buddy Check Review below!\n\nBuddy Check allows you to find out who all the un-engaged / inactive friends are on your friends list and quickly remove them with a couple clicks of the mouse! It’s a web based software that can be accessed from anywhere you have internet service.\n\nIn other words, This is a tool that allows you to sort through your least engaged friends using several powerful filters AND remove them with a couple clicks of the mouse! But remember…. removing your least engaged friends is just PART of the success formula on Facebook. You also need to fill your friends list with people who are likely to be interested in your posts. Don’t worry, they’ve got you covered! Scroll down for more details!\n\nBuddy Check works for selling ANYTHING! It’s just an easier way to get more TARGETED eyeballs looking at your offers on a daily basis! The best part is you don’t need any of the following to start profiting with Buddy Check:\n\n- Email List: Using buddy check you can build a targeted audience who you can promote to for free!\n- Your Own Products: There are thousands of affiliate offers you can promote if you don’t have any of your own products to sell.\n- Paid Advertisements: No need to spend hundreds or thousands of dollars on Facebook, Instagram, YouTube, or Google Ads!\n- Experience: It doesn’t matter if you’re a complete newbie or a seasoned marketer. Buddy Check is simple to use and flat out WORKS!\n\nCheck more here :\nhttps://reviewjvzoo.com/buddy-check-by-chris-beatty-review-increase-engagement-rates-on-your-facebook-account-by-quickly-removing-all-the-dead-weight-friends-who-never-interact-with-you-and-add-targeted-prospects-to-yo/\n\nTAgs : Buddy Check by Chris Beatty Review, Demo Buddy Check by Chris Beatty Review, buddy check, buddy check bonus, buddy check bonus review, buddy check chris beatty, buddy check demo, buddy check honest review, buddy check oto, buddy check oto review, buddy check review bonus, buddy check review by users, buddy check review oto, buddy check review upsell, buddy check upsell, buddy check upsell review, buy buddy check, download buddy check, get buddy check, purchase buddy check, Buddy check premium review, Billed one single payment review,",
      "json_metadata": "{\"tags\":[\"buddycheck\",\"bychrisbeatty\",\"review\",\"buddycheckreview\"],\"links\":[\"https://reviewjvzoo.com/buddy-check-by-chris-beatty-review-increase-engagement-rates-on-your-facebook-account-by-quickly-removing-all-the-dead-weight-friends-who-never-interact-with-you-and-add-targeted-prospects-to-yo/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "buddycheck",
      "permlink": "buddycheck-bychrisbeatty-review-buddycheckreview-buddy-check-by-chris-beatty-review",
      "title": "buddycheck bychrisbeatty review , buddycheckreview , Buddy Check by Chris Beatty Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-28T04:29:09",
  "trx_id": "0c30e6e9d41496f9570eb5b9117cbf11dfde3386",
  "trx_in_block": 14,
  "virtual_op": 0
}
2018/04/27 20:51:36
authorsteemitboard
bodyCongratulations @gurureviewer! You have completed some achievement on Steemit and have been rewarded with new badge(s) : [![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/firstpayout.png)](http://steemitboard.com/@gurureviewer) You got your First payout Click on any badge to view your own Board of Honor on SteemitBoard. For more information about SteemitBoard, click [here](https://steemit.com/@steemitboard) If you no longer want to receive notifications, reply to this comment with the word `STOP` > Upvote this notification to help all Steemit users. Learn why [here](https://steemit.com/steemitboard/@steemitboard/http-i-cubeupload-com-7ciqeo-png)!
json metadata{"image":["https://steemitboard.com/img/notifications.png"]}
parent authorgurureviewer
parent permlinkuduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review
permlinksteemitboard-notify-gurureviewer-20180427t205135000z
title
Transaction InfoBlock #21943442/Trx f8b075ae66f0006110e03acf2ea17c878e9d0ded
View Raw JSON Data
{
  "block": 21943442,
  "op": [
    "comment",
    {
      "author": "steemitboard",
      "body": "Congratulations @gurureviewer! You have completed some achievement on Steemit and have been rewarded with new badge(s) :\n\n[![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/firstpayout.png)](http://steemitboard.com/@gurureviewer) You got your First payout\n\nClick on any badge to view your own Board of Honor on SteemitBoard.\nFor more information about SteemitBoard, click [here](https://steemit.com/@steemitboard)\n\nIf you no longer want to receive notifications, reply to this comment with the word `STOP`\n\n> Upvote this notification to help all Steemit users. Learn why [here](https://steemit.com/steemitboard/@steemitboard/http-i-cubeupload-com-7ciqeo-png)!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notifications.png\"]}",
      "parent_author": "gurureviewer",
      "parent_permlink": "uduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review",
      "permlink": "steemitboard-notify-gurureviewer-20180427t205135000z",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-27T20:51:36",
  "trx_id": "f8b075ae66f0006110e03acf2ea17c878e9d0ded",
  "trx_in_block": 6,
  "virtual_op": 0
}
2018/04/27 14:08:21
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkuduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review
permlinkcheetah-re-gururevieweruduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review
title
Transaction InfoBlock #21935381/Trx 66e0c67ee19daaaab9db8cfbe8f74946b66b4625
View Raw JSON Data
{
  "block": 21935381,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "uduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review",
      "permlink": "cheetah-re-gururevieweruduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-27T14:08:21",
  "trx_id": "66e0c67ee19daaaab9db8cfbe8f74946b66b4625",
  "trx_in_block": 24,
  "virtual_op": 0
}
2018/04/27 14:07:45
authorgurureviewer
bodyUduala gives you access to a team of experienced Ecom experts who will do all of your product research, supplier research, product copy creation, image creation and Facebook ad creation for you. The Facebook ads are written by copy experts, and you’ll even get the exact targeting for ‘can’t fail’ campaigns. But of course, not everyone who sees your ads will click and buy. Now, You Can Get Your Uduala Team Of Experts To Create Proven, Traffic Pulling, Professional Video Ads For EVERY Recommended Product! Check more Here : https://reviewjvzoo.com/uduala-ecom-by-victory-akpomedaye-review-discover-the-easiest-beginner-friendly-method-that-the-new-breed-of-ecom-high-earners-are-using-to-go-from-0-to-5-figure-ecom-store-owner/ Tags : Tags : Uduala eCom, Uduala eCom review, Uduala eCom by Victory Akpos review, Uduala eCom by Victory Akpos, Demo Uduala eCom by Victory Akpomedaye review, Uduala eCom by Victory Akpomedaye, Uduala eCom by Victory Akpomedaye- Should you Buy It?, Uduala eCom by Victory Akpomedaye- The best prices, Uduala eCom by Victory AkpomedayeA Quick Peek Inside, Uduala eCom by Victory AkpomedayeBonus, Uduala eCom by Victory AkpomedayeBonuses, Uduala eCom by Victory AkpomedayeBuy, Uduala eCom by Victory AkpomedayeDiscount And Massive Bonus, Uduala eCom by Victory AkpomedayeHonest Review, Uduala eCom by Victory AkpomedayeHow to Buy?, Uduala eCom by Victory AkpomedayeIs It Worth It?, Uduala eCom by Victory AkpomedayeMega Bonus, Uduala eCom by Victory AkpomedayeReview, Uduala eCom by Victory AkpomedayeReview And Bonus Buy Here, Uduala eCom by Victory AkpomedayeReview And Bonus Buy With Confidence, Uduala eCom by Victory AkpomedayeReview And Bonus Do I Really Need it, Uduala eCom by Victory AkpomedayeShould I buy it?, Uduala eCom by Victory AkpomedayeWho is thisfor?, Uduala eCom by Victory Akpomedaye OTO1, Uduala eCom by Victory Akpomedaye OTO2, review Uduala eCom by Victory Akpomedaye, OTO 1 : Uduala DFY Video Ads review, OTO 2 : Uduala DFY 100+ eMail Templates review, OTO 3 : Uduala ClickFOMO review, OTO 4 : Uduala DFY eCom Setup review.
json metadata{"tags":["udualaecom","byvictoryakpomedaye","review","udualaecomreview"],"links":["https://reviewjvzoo.com/uduala-ecom-by-victory-akpomedaye-review-discover-the-easiest-beginner-friendly-method-that-the-new-breed-of-ecom-high-earners-are-using-to-go-from-0-to-5-figure-ecom-store-owner/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkudualaecom
permlinkuduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review
titleUduala eCom by Victory Akpomedaye Review , Uduala eCom by Victory Akpomedaye Review
Transaction InfoBlock #21935369/Trx bf43e42757bab51a6dd521e70efad93936ed988e
View Raw JSON Data
{
  "block": 21935369,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Uduala gives you access to a team of experienced Ecom experts who will do all of your product research, supplier research, product copy creation, image creation and Facebook ad creation for you. The Facebook ads are written by copy experts, and you’ll even get the exact targeting for ‘can’t fail’ campaigns. But of course, not everyone who sees your ads will click and buy. Now, You Can Get Your Uduala Team Of Experts To Create Proven, Traffic Pulling, Professional Video Ads For EVERY Recommended Product!\n\nCheck more Here :\nhttps://reviewjvzoo.com/uduala-ecom-by-victory-akpomedaye-review-discover-the-easiest-beginner-friendly-method-that-the-new-breed-of-ecom-high-earners-are-using-to-go-from-0-to-5-figure-ecom-store-owner/\n\nTags : Tags : Uduala eCom, Uduala eCom review, Uduala eCom by Victory Akpos review, Uduala eCom by Victory Akpos, Demo Uduala eCom by Victory Akpomedaye review, Uduala eCom by Victory Akpomedaye, Uduala eCom by Victory Akpomedaye- Should you Buy It?, Uduala eCom by Victory Akpomedaye- The best prices, Uduala eCom by Victory AkpomedayeA Quick Peek Inside, Uduala eCom by Victory AkpomedayeBonus, Uduala eCom by Victory AkpomedayeBonuses, Uduala eCom by Victory AkpomedayeBuy, Uduala eCom by Victory AkpomedayeDiscount And Massive Bonus, Uduala eCom by Victory AkpomedayeHonest Review, Uduala eCom by Victory AkpomedayeHow to Buy?, Uduala eCom by Victory AkpomedayeIs It Worth It?, Uduala eCom by Victory AkpomedayeMega Bonus, Uduala eCom by Victory AkpomedayeReview, Uduala eCom by Victory AkpomedayeReview And Bonus Buy Here, Uduala eCom by Victory AkpomedayeReview And Bonus Buy With Confidence, Uduala eCom by Victory AkpomedayeReview And Bonus Do I Really Need it, Uduala eCom by Victory AkpomedayeShould I buy it?, Uduala eCom by Victory AkpomedayeWho is thisfor?, Uduala eCom by Victory Akpomedaye OTO1, Uduala eCom by Victory Akpomedaye OTO2, review Uduala eCom by Victory Akpomedaye, OTO 1 : Uduala DFY Video Ads review, OTO 2 : Uduala DFY 100+ eMail Templates review, OTO 3 : Uduala ClickFOMO review, OTO 4 : Uduala DFY eCom Setup review.",
      "json_metadata": "{\"tags\":[\"udualaecom\",\"byvictoryakpomedaye\",\"review\",\"udualaecomreview\"],\"links\":[\"https://reviewjvzoo.com/uduala-ecom-by-victory-akpomedaye-review-discover-the-easiest-beginner-friendly-method-that-the-new-breed-of-ecom-high-earners-are-using-to-go-from-0-to-5-figure-ecom-store-owner/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "udualaecom",
      "permlink": "uduala-ecom-by-victory-akpomedaye-review-uduala-ecom-by-victory-akpomedaye-review",
      "title": "Uduala eCom by Victory Akpomedaye Review , Uduala eCom by Victory Akpomedaye Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-27T14:07:45",
  "trx_id": "bf43e42757bab51a6dd521e70efad93936ed988e",
  "trx_in_block": 43,
  "virtual_op": 0
}
2018/04/26 16:40:03
authorgurureviewer
permlinkrealspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review
voteranomaly
weight100 (1.00%)
Transaction InfoBlock #21909629/Trx 51f4e209f3c97b910aff1ba97b41df9e4cfed01e
View Raw JSON Data
{
  "block": 21909629,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "realspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review",
      "voter": "anomaly",
      "weight": 100
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-26T16:40:03",
  "trx_id": "51f4e209f3c97b910aff1ba97b41df9e4cfed01e",
  "trx_in_block": 33,
  "virtual_op": 0
}
2018/04/26 16:05:36
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkrealspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review
permlinkcheetah-re-gurureviewerrealspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review
title
Transaction InfoBlock #21908940/Trx 5863913c4acf0a5e12bddfa704c1e6c4104d9649
View Raw JSON Data
{
  "block": 21908940,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "realspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review",
      "permlink": "cheetah-re-gurureviewerrealspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-26T16:05:36",
  "trx_id": "5863913c4acf0a5e12bddfa704c1e6c4104d9649",
  "trx_in_block": 36,
  "virtual_op": 0
}
2018/04/26 16:05:15
authorgurureviewer
permlinkrealspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21908933/Trx bca7013d3fd94fe23076c2fe9d421334d2c38cd8
View Raw JSON Data
{
  "block": 21908933,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "realspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-26T16:05:15",
  "trx_id": "bca7013d3fd94fe23076c2fe9d421334d2c38cd8",
  "trx_in_block": 19,
  "virtual_op": 0
}
2018/04/26 16:05:00
authorgurureviewer
bodyRealSpecific Content Marketing Software by Justin Anderson is Best Software To Get Powerful Content On Complete Autopilot As Well As Track Sites In Your Niche And Drive Traffic & Engagement On Your Website And Publish To Both Your Social Accounts And Your Blogs. Real Specific Content Marketing Software by Justin Anderson is very powerful and recommended for all internet marketers. The best features of Real Specific is Total Marketing Automation, Just pick what type of content you’re looking for, which of your blogs/accounts you want it posted to, and relax while our systems do the work for you. Instant Results, Just pick what type of content you’re looking for, which of your blogs/accounts you want it posted to, and relax while our systems do the work for you. Detailed Training, For those of you that are a bit more experienced, we have a fantastic help area that has step-by-step videos, FAQ, and a quick start guide. Laser Focused Curation, Just want to stop the time-sucking research and content writing? We bubble up only the most viral and trending content for you to publish. Detailed Reporting, Dashboard view that enables you to see which website content and accounts are getting the most interactions. Amazing Support, We’ve helped our customers use our technology and we’ll be happy to help you implement best practices so you can see success too. Customizable Niche Content, When you have specific content needs, trending viral content may not always be what you’re looking for. Add RSS feeds of sites in your niche and we track at THOSE for the best content. Super Easy to Use, This service is so easy to get up publishing content, you’ll be up and running in under a minute. Tweak posts to your liking and get your traffic and engagement growing fast and many more. It is Killer WordPress And Social Automation, Delight Content Discovery, Effortly Posting. Real Specific is a web-based service that makes content marketing and social media fun. We’ve made content discovery delightful, bubbling up the viral and trending content from the web in general as well as track sites in your niche. From the Discovery dashboard you can easily publish to both your social accounts and your blogs. Real Specific immediately solves your content creation and distribution headaches. The Smartest, Most Powerful Way to Improve Blog Traffic and Engagement. This is an amazing proven SaaS with MASSIVE PROOF, It’ll make your customers (and their blogs and social accounts) happy AND bring you insane monthly recurring revenue on autopilot. Help You find trending stories globally and in their niche & Curate the content to post on WP and social media (including autopilot). We call this discovery and painless publishing and it’s what makes us so much better than Hootsuite, BuzzSumo, and other expensive and complicated services. Connect up to 10 web sites, 50 social accounts, and 5 custom data feeds. Includes bonuses “WP Bounce Rate Fixer”, a custom branded shortener URL, 3 viral WordPress themes, and 3 content related bonuses. Tired of wasting time and money on methods and software that don’t get you the traffic you need? See Andrew Used Real Specific To Get 100% FREE Traffic That Banked Him $77,420 In Just 28 Days. (Yes, It’s A Brand New Social Media + WordPress Software That Actually Works!). Get Real Specific Content Software by Justin Anderson now! Checkmore here : https://reviewjvzoo.com/real-specific-pro-web-base-software-by-simon-warner-review-the-best-way-to-start-bringing-in-free-trafficleads-in-under-3-minutes-now-you-can-find-fresh-viral-content-automatically-grow-your-wor/ Tags : Download RealSpecific, Get RealSpecific, OTO #1 - Real Specific 5X PRO And SEO Upgrade OTO, OTO #2 - Real Specific Traffic Training OTO, OTO RealSpecific, PRO RealSpecific, Real Specific Content Creation Software by Justin Anderson, Real Specific Content Creation Software by Justin Anderson Bonus, Real Specific Content Creation Software by Justin Anderson Demo Software, Real Specific Content Creation Software by Justin Anderson Download, Real Specific Content Creation Software by Justin Anderson JVZoo, Real Specific Content Creation Software by Justin Anderson OTO Upsell, Real Specific Content Creation Software by Justin Anderson Review, Real Specific Content Creation Software by Justin Anderson Video Training, Real Specific Content Creation Software by Shane Brooks, Real Specific Content Creation Software by Simon Warner, Real Specific Content Marketing Creation Software by Justin Anderson, Real Specific Power by Justin Anderson, Real Specific Traffic Training, Real Specific Viral Content Creation Software by Justin Anderson, Real Specific Viral Content Marketing by Justin Anderson, RealSpecific by Justin Anderson, Upsell RealSpecific
json metadata{"tags":["realspecificreview"],"links":["https://reviewjvzoo.com/real-specific-pro-web-base-software-by-simon-warner-review-the-best-way-to-start-bringing-in-free-trafficleads-in-under-3-minutes-now-you-can-find-fresh-viral-content-automatically-grow-your-wor/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkrealspecificreview
permlinkrealspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review
titlerealspecificreview , realspecific by Justin Anderson review, realspecific by simon warner review
Transaction InfoBlock #21908928/Trx c5c728760623baf520c2cfa3991b8ce5d881cc9b
View Raw JSON Data
{
  "block": 21908928,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "RealSpecific Content Marketing Software by Justin Anderson is Best Software To Get Powerful Content On Complete Autopilot As Well As Track Sites In Your Niche And Drive Traffic & Engagement On Your Website And Publish To Both Your Social Accounts And Your Blogs. Real Specific Content Marketing Software by Justin Anderson is very powerful and recommended for all internet marketers. The best features of Real Specific is Total Marketing Automation, Just pick what type of content you’re looking for, which of your blogs/accounts you want it posted to, and relax while our systems do the work for you. Instant Results, Just pick what type of content you’re looking for, which of your blogs/accounts you want it posted to, and relax while our systems do the work for you. Detailed Training, For those of you that are a bit more experienced, we have a fantastic help area that has step-by-step videos, FAQ, and a quick start guide. Laser Focused Curation, Just want to stop the time-sucking research and content writing? We bubble up only the most viral and trending content for you to publish. Detailed Reporting, Dashboard view that enables you to see which website content and accounts are getting the most interactions. Amazing Support, We’ve helped our customers use our technology and we’ll be happy to help you implement best practices so you can see success too. Customizable Niche Content, When you have specific content needs, trending viral content may not always be what you’re looking for. Add RSS feeds of sites in your niche and we track at THOSE for the best content. Super Easy to Use, This service is so easy to get up publishing content, you’ll be up and running in under a minute. Tweak posts to your liking and get your traffic and engagement growing fast and many more. It is Killer WordPress And Social Automation, Delight Content Discovery, Effortly Posting. Real Specific is a web-based service that makes content marketing and social media fun. We’ve made content discovery delightful, bubbling up the viral and trending content from the web in general as well as track sites in your niche. From the Discovery dashboard you can easily publish to both your social accounts and your blogs. Real Specific immediately solves your content creation and distribution headaches. The Smartest, Most Powerful Way to Improve Blog Traffic and Engagement. This is an amazing proven SaaS with MASSIVE PROOF, It’ll make your customers (and their blogs and social accounts) happy AND bring you insane monthly recurring revenue on autopilot. Help You find trending stories globally and in their niche & Curate the content to post on WP and social media (including autopilot). We call this discovery and painless publishing and it’s what makes us so much better than Hootsuite, BuzzSumo, and other expensive and complicated services. Connect up to 10 web sites, 50 social accounts, and 5 custom data feeds. Includes bonuses “WP Bounce Rate Fixer”, a custom branded shortener URL, 3 viral WordPress themes, and 3 content related bonuses. Tired of wasting time and money on methods and software that don’t get you the traffic you need? See Andrew Used Real Specific To Get 100% FREE Traffic That Banked Him $77,420 In Just 28 Days. (Yes, It’s A Brand New Social Media + WordPress Software That Actually Works!). Get Real Specific Content Software by Justin Anderson now!\n\nCheckmore here :\nhttps://reviewjvzoo.com/real-specific-pro-web-base-software-by-simon-warner-review-the-best-way-to-start-bringing-in-free-trafficleads-in-under-3-minutes-now-you-can-find-fresh-viral-content-automatically-grow-your-wor/\n\nTags : Download RealSpecific, Get RealSpecific, OTO #1 - Real Specific 5X PRO And SEO Upgrade OTO, OTO #2 - Real Specific Traffic Training OTO, OTO RealSpecific, PRO RealSpecific, Real Specific Content Creation Software by Justin Anderson, Real Specific Content Creation Software by Justin Anderson Bonus, Real Specific Content Creation Software by Justin Anderson Demo Software, Real Specific Content Creation Software by Justin Anderson Download, Real Specific Content Creation Software by Justin Anderson JVZoo, Real Specific Content Creation Software by Justin Anderson OTO Upsell, Real Specific Content Creation Software by Justin Anderson Review, Real Specific Content Creation Software by Justin Anderson Video Training, Real Specific Content Creation Software by Shane Brooks, Real Specific Content Creation Software by Simon Warner, Real Specific Content Marketing Creation Software by Justin Anderson, Real Specific Power by Justin Anderson, Real Specific Traffic Training, Real Specific Viral Content Creation Software by Justin Anderson, Real Specific Viral Content Marketing by Justin Anderson, RealSpecific by Justin Anderson, Upsell RealSpecific",
      "json_metadata": "{\"tags\":[\"realspecificreview\"],\"links\":[\"https://reviewjvzoo.com/real-specific-pro-web-base-software-by-simon-warner-review-the-best-way-to-start-bringing-in-free-trafficleads-in-under-3-minutes-now-you-can-find-fresh-viral-content-automatically-grow-your-wor/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "realspecificreview",
      "permlink": "realspecificreview-realspecific-by-justin-anderson-review-realspecific-by-simon-warner-review",
      "title": "realspecificreview , realspecific by Justin Anderson review,  realspecific by simon warner review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-26T16:05:00",
  "trx_id": "c5c728760623baf520c2cfa3991b8ce5d881cc9b",
  "trx_in_block": 1,
  "virtual_op": 0
}
2018/04/25 16:52:33
authorgurureviewer
permlinkkevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21881093/Trx 0cab983ae74aaea1efce1fa38bf1777ffea5e377
View Raw JSON Data
{
  "block": 21881093,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "kevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T16:52:33",
  "trx_id": "0cab983ae74aaea1efce1fa38bf1777ffea5e377",
  "trx_in_block": 7,
  "virtual_op": 0
}
2018/04/25 16:52:27
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkkevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review
permlinkcheetah-re-gurureviewerkevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review
title
Transaction InfoBlock #21881091/Trx a77d037db4cb825a50c8ea8770d3fe42ecade818
View Raw JSON Data
{
  "block": 21881091,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "kevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review",
      "permlink": "cheetah-re-gurureviewerkevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T16:52:27",
  "trx_id": "a77d037db4cb825a50c8ea8770d3fe42ecade818",
  "trx_in_block": 28,
  "virtual_op": 0
}
2018/04/25 16:52:18
authorgurureviewer
permlinkkevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21881088/Trx 866032f9b1091026a53a64bfbcbdd296d2857e32
View Raw JSON Data
{
  "block": 21881088,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "kevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T16:52:18",
  "trx_id": "866032f9b1091026a53a64bfbcbdd296d2857e32",
  "trx_in_block": 21,
  "virtual_op": 0
}
2018/04/25 16:51:51
authorgurureviewer
bodyKevin Fahey’s IM Coaching Series 2018 is a PROVEN training that shows people the fastest and most proven way to grow their business via 12 LIVE Weekly Power Packed Webinars. Ie product creation, building a buyers list and profiting. Everything is covered inside nothing is left out. After purchase you’ll be automatically registered for 12 weeks of live webinar training. Each webinar will be approximately 90 minutes long where everything will be covered from creating your product, creating a profitable sales funnel, finding affiliate partners, getting traffic, selling high ticket programs and so much more. On top of the 12 weeks you’ll have lifetime access to all previous group coaching sessions and future sessions for years to come. Every time he opens a new session you’ll be invited to come. You’ll also get instant access to a Facebook Group where you can begin asking questions and masterminding with other marketers. You’ll also have access to Kevin on Facebook, via support desk and email.' ' Here is the first look of what you will get inside: - Live Training Every Saturday at 10am EST for the year of 2018 (Over 36 LIVE Webinars) - Access to all Kevin’s products and membership sites, past present and future. (For Up To 2 Years) - Access to his reseller program where you earn 100% commission on 14 of his 16 products. - Access to the NEW IM VIP Training Portal with over 130 webinar replays and 240 marketing lessons. - 2 x One-on-One Coaching Calls With Kevin Fahey Personally I am going to show you more in the next parts of this Kevin Fahey’s IM Coaching Series 2018 Review! Check more here : https://reviewjvzoo.com/kevin-faheys-im-coaching-series-2018-by-kevin-fahey-review-discover-a-proven-training-that-shows-people-the-fastest-and-most-proven-way-to-grow-their-business-via-12-live-weekly-power-packed-webin/ Tags : Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey review, Kevin Fahey's IM Coaching Series 2018, Kevin Fahey's IM Coaching Series 2018 Bonus and Download by Kevin Fahey, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Download, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey JVzoo, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey OTO Upsell, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Review, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Review Pro Bonus and Download, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Tutorial, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Video Training, Kevin Fahey's IM Coaching Series 2018 Demo and Interview with Kevin Fahey, Kevin Fahey's IM Coaching Series 2018 Download, Kevin Fahey's IM Coaching Series 2018 JVzoo, Kevin Fahey's IM Coaching Series 2018 OTO, Kevin Fahey's IM Coaching Series 2018 OTO Upgrade Upsell by Kevin Fahey, Kevin Fahey's IM Coaching Series 2018 PRO OTO Upgrade, Kevin Fahey's IM Coaching Series 2018 PRO Version OTO, Kevin Fahey's IM Coaching Series 2018 Upsell
json metadata{"tags":["kevinfaheysimcoaching","series2018","review"],"links":["https://reviewjvzoo.com/kevin-faheys-im-coaching-series-2018-by-kevin-fahey-review-discover-a-proven-training-that-shows-people-the-fastest-and-most-proven-way-to-grow-their-business-via-12-live-weekly-power-packed-webin/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkkevinfaheysimcoaching
permlinkkevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review
titleKevin Fahey’s IM Coaching Series 2018 review , Kevin Fahey’s IM Coaching Series 2018 by kevin fahey review
Transaction InfoBlock #21881079/Trx 213c80ba1cda4b07417f2a20574ec261cceb20be
View Raw JSON Data
{
  "block": 21881079,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Kevin Fahey’s IM Coaching Series 2018 is a PROVEN training that shows people the fastest and most proven way to grow their business via 12 LIVE Weekly Power Packed Webinars. Ie product creation, building a buyers list and profiting. Everything is covered inside nothing is left out.\n\nAfter purchase you’ll be automatically registered for 12 weeks of live webinar training. Each webinar will be approximately 90 minutes long where everything will be covered from creating your product, creating a profitable sales funnel, finding affiliate partners, getting traffic, selling high ticket programs and so much more.\n\nOn top of the 12 weeks you’ll have lifetime access to all previous group coaching sessions and future sessions for years to come. Every time he opens a new session you’ll be invited to come.\n\nYou’ll also get instant access to a Facebook Group where you can begin asking questions and masterminding with other marketers. You’ll also have access to Kevin on Facebook, via support desk and email.'\n'\nHere is the first look of what you will get inside:\n\n- Live Training Every Saturday at 10am EST for the year of 2018 (Over 36 LIVE Webinars)\n- Access to all Kevin’s products and membership sites, past present and future. (For Up To 2 Years)\n- Access to his reseller program where you earn 100% commission on 14 of his 16 products.\n- Access to the NEW IM VIP Training Portal with over 130 webinar replays and 240 marketing lessons.\n- 2 x One-on-One Coaching Calls With Kevin Fahey Personally\n\nI am going to show you more in the next parts of this Kevin Fahey’s IM Coaching Series 2018 Review! \n\nCheck more here :\nhttps://reviewjvzoo.com/kevin-faheys-im-coaching-series-2018-by-kevin-fahey-review-discover-a-proven-training-that-shows-people-the-fastest-and-most-proven-way-to-grow-their-business-via-12-live-weekly-power-packed-webin/\n\nTags : Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey review, Kevin Fahey's IM Coaching Series 2018, Kevin Fahey's IM Coaching Series 2018 Bonus and Download by Kevin Fahey, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Download, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey JVzoo, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey OTO Upsell, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Review, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Review Pro Bonus and Download, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Tutorial, Kevin Fahey's IM Coaching Series 2018 by Kevin Fahey Video Training, Kevin Fahey's IM Coaching Series 2018 Demo and Interview with Kevin Fahey, Kevin Fahey's IM Coaching Series 2018 Download, Kevin Fahey's IM Coaching Series 2018 JVzoo, Kevin Fahey's IM Coaching Series 2018 OTO, Kevin Fahey's IM Coaching Series 2018 OTO Upgrade Upsell by Kevin Fahey, Kevin Fahey's IM Coaching Series 2018 PRO OTO Upgrade, Kevin Fahey's IM Coaching Series 2018 PRO Version OTO, Kevin Fahey's IM Coaching Series 2018 Upsell",
      "json_metadata": "{\"tags\":[\"kevinfaheysimcoaching\",\"series2018\",\"review\"],\"links\":[\"https://reviewjvzoo.com/kevin-faheys-im-coaching-series-2018-by-kevin-fahey-review-discover-a-proven-training-that-shows-people-the-fastest-and-most-proven-way-to-grow-their-business-via-12-live-weekly-power-packed-webin/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "kevinfaheysimcoaching",
      "permlink": "kevin-fahey-s-im-coaching-series-2018-review-kevin-fahey-s-im-coaching-series-2018-by-kevin-fahey-review",
      "title": "Kevin Fahey’s IM Coaching Series 2018 review , Kevin Fahey’s IM Coaching Series 2018 by kevin fahey review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T16:51:51",
  "trx_id": "213c80ba1cda4b07417f2a20574ec261cceb20be",
  "trx_in_block": 16,
  "virtual_op": 0
}
2018/04/25 13:35:15
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkwp-search-killer-by-markslater-review-wp-search-killer-review
permlinkcheetah-re-gurureviewerwp-search-killer-by-markslater-review-wp-search-killer-review
title
Transaction InfoBlock #21877147/Trx 355e845941955453e9d5777f20cb749310829767
View Raw JSON Data
{
  "block": 21877147,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "wp-search-killer-by-markslater-review-wp-search-killer-review",
      "permlink": "cheetah-re-gurureviewerwp-search-killer-by-markslater-review-wp-search-killer-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T13:35:15",
  "trx_id": "355e845941955453e9d5777f20cb749310829767",
  "trx_in_block": 22,
  "virtual_op": 0
}
2018/04/25 13:34:33
authorgurureviewer
bodyWP Search Killer by MarkSlater review – Protect your site from Leeches… Searching for your Download Pages and Private Content! Protect your site from Leeches… Searching for your Download Pages and Private Content!. You probably don’t realise this… but it only takes seconds for someone who knows what they are doing… to find your Download Pages and Private Content. And worst still… then they might share these pages over the Internet… including Blackhat Sites, Even if you remove the WordPress Search Widget… people can still search your site and find these pages. WP Search Killer will do the following on your website, Remove the WordPress Search Widgets from displaying, Re-Direct a WordPress Search URL either entered directly into a Browser… or through a WordPress Search Field… to any URL you choose (even a URL on a different site). Check more here : https://reviewjvzoo.com/wp-search-killer-by-markslater-review-protect-your-site-from-leeches-searching-for-your-download-pages-and-private-content/ tags : Demo WP Search Killer by MarkSlater review review, review WP Search Killer by MarkSlater review, WP Search Killer by MarkSlater review, WP Search Killer by MarkSlater review OTO1, WP Search Killer by MarkSlater review OTO2, WP Search Killer by MarkSlater review- Should you Buy It?, WP Search Killer by MarkSlater review- The best prices, WP Search Killer by MarkSlater reviewA Quick Peek Inside, WP Search Killer by MarkSlater reviewBonus, WP Search Killer by MarkSlater reviewBonuses, WP Search Killer by MarkSlater reviewBuy, WP Search Killer by MarkSlater reviewDiscount And Massive Bonus, WP Search Killer by MarkSlater reviewHonest Review, WP Search Killer by MarkSlater reviewHow to Buy?, WP Search Killer by MarkSlater reviewIs It Worth It?, WP Search Killer by MarkSlater reviewMega Bonus, WP Search Killer by MarkSlater reviewReview, WP Search Killer by MarkSlater reviewReview And Bonus Buy Here, WP Search Killer by MarkSlater reviewReview And Bonus Buy With Confidence, WP Search Killer by MarkSlater reviewReview And Bonus Do I Really Need it, WP Search Killer by MarkSlater reviewShould I buy it?, WP Search Killer by MarkSlater reviewWho is thisfor?
json metadata{"tags":["wpsearchkiller","by","markslater","review","wpsearchkillerreview"],"links":["https://reviewjvzoo.com/wp-search-killer-by-markslater-review-protect-your-site-from-leeches-searching-for-your-download-pages-and-private-content/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkwpsearchkiller
permlinkwp-search-killer-by-markslater-review-wp-search-killer-review
titleWP Search Killer by MarkSlater review , WP Search Killer review
Transaction InfoBlock #21877133/Trx 42ddb0fe38391f3e2a127911cd512c8a9f026fef
View Raw JSON Data
{
  "block": 21877133,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "WP Search Killer by MarkSlater review – Protect your site from Leeches… Searching for your Download Pages and Private Content!\nProtect your site from Leeches… Searching for your Download Pages and Private Content!. You probably don’t realise this… but it only takes seconds for someone who knows what they are doing… to find your Download Pages and Private Content. And worst still… then they might share these pages over the Internet… including Blackhat Sites, Even if you remove the WordPress Search Widget… people can still search your site and find these pages.\nWP Search Killer will do the following on your website, Remove the WordPress Search Widgets from displaying, Re-Direct a WordPress Search URL either entered directly into a Browser… or through a WordPress Search Field… to any URL you choose (even a URL on a different site).\n\nCheck more here : \nhttps://reviewjvzoo.com/wp-search-killer-by-markslater-review-protect-your-site-from-leeches-searching-for-your-download-pages-and-private-content/\n\ntags : Demo WP Search Killer by MarkSlater review review, review WP Search Killer by MarkSlater review, WP Search Killer by MarkSlater review, WP Search Killer by MarkSlater review OTO1, WP Search Killer by MarkSlater review OTO2, WP Search Killer by MarkSlater review- Should you Buy It?, WP Search Killer by MarkSlater review- The best prices, WP Search Killer by MarkSlater reviewA Quick Peek Inside, WP Search Killer by MarkSlater reviewBonus, WP Search Killer by MarkSlater reviewBonuses, WP Search Killer by MarkSlater reviewBuy, WP Search Killer by MarkSlater reviewDiscount And Massive Bonus, WP Search Killer by MarkSlater reviewHonest Review, WP Search Killer by MarkSlater reviewHow to Buy?, WP Search Killer by MarkSlater reviewIs It Worth It?, WP Search Killer by MarkSlater reviewMega Bonus, WP Search Killer by MarkSlater reviewReview, WP Search Killer by MarkSlater reviewReview And Bonus Buy Here, WP Search Killer by MarkSlater reviewReview And Bonus Buy With Confidence, WP Search Killer by MarkSlater reviewReview And Bonus Do I Really Need it, WP Search Killer by MarkSlater reviewShould I buy it?, WP Search Killer by MarkSlater reviewWho is thisfor?",
      "json_metadata": "{\"tags\":[\"wpsearchkiller\",\"by\",\"markslater\",\"review\",\"wpsearchkillerreview\"],\"links\":[\"https://reviewjvzoo.com/wp-search-killer-by-markslater-review-protect-your-site-from-leeches-searching-for-your-download-pages-and-private-content/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "wpsearchkiller",
      "permlink": "wp-search-killer-by-markslater-review-wp-search-killer-review",
      "title": "WP Search Killer by MarkSlater review , WP Search Killer review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T13:34:33",
  "trx_id": "42ddb0fe38391f3e2a127911cd512c8a9f026fef",
  "trx_in_block": 6,
  "virtual_op": 0
}
2018/04/25 07:23:57
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkspinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review
permlinkcheetah-re-gurureviewerspinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review
title
Transaction InfoBlock #21869722/Trx d27a987c168407fcfcace6be54daa6c62120f77d
View Raw JSON Data
{
  "block": 21869722,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "spinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review",
      "permlink": "cheetah-re-gurureviewerspinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T07:23:57",
  "trx_id": "d27a987c168407fcfcace6be54daa6c62120f77d",
  "trx_in_block": 17,
  "virtual_op": 0
}
2018/04/25 07:23:45
authorgurureviewer
permlinkspinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21869718/Trx c77e5cc40b84fb5bfbf3cc49c87fcf6cf7139958
View Raw JSON Data
{
  "block": 21869718,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "spinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T07:23:45",
  "trx_id": "c77e5cc40b84fb5bfbf3cc49c87fcf6cf7139958",
  "trx_in_block": 44,
  "virtual_op": 0
}
2018/04/25 07:23:03
authorgurureviewer
body“Getting Off The Ground Is Hard!” Sure, eventually when you stick with it, you can absolutely make it. Thing is, it does take time. It does not happen overnight for anyone. You get so caught up learning all this stuff that it becomes overwhelming. And there are some things that most people don’t really want to do. Listen, you probably already know a lot more than you give yourself credit for. In my own journey I found that certain things are much easier than others. Things like content or copywriting are just plain tough, and totally boring to me. Other things like traffic, are really not that hard. Especially when you have a foolproof system to follow. That’s when I discovered this foolproof system that produced real results for me. Let’s check out my SP Influencer 3.0 Review below for more details! After the success of SP Influencer 2.0 and 1.0, The author created version 3.0 to expand upon the core principles of this newbie friendly course that will have you stuffing your Paypal accounts full of cash almost instantly. In a nutshell, SP Influencer 3.0 is a training that shows you how to Get LinkedIn’s TOP influencers promoting your offers absolutely free, sending floods of traffic, opt-ins, sales and much more. Check Here : https://reviewjvzoo.com/sp-influencer-3-0-by-paul-favors-review-get-all-the-money-churning-email-subscribers-sales-and-clients-youll-ever-need-on-autopilot-using-this-underground-marketing-legends-inspired-nev/ Tags : SP Influencer 3.0, SP Influencer 3.0 review, Demo SP Influencer 3.0 by Paul Favors Review review, SP Influencer 3.0 by Paul Favors Review, SP Influencer 3.0 by Paul Favors Review- Should you Buy It?, SP Influencer 3.0 by Paul Favors Review- The best prices, SP Influencer 3.0 by Paul Favors ReviewA Quick Peek Inside, SP Influencer 3.0 by Paul Favors ReviewBonus, SP Influencer 3.0 by Paul Favors ReviewBonuses, SP Influencer 3.0 by Paul Favors ReviewBuy, SP Influencer 3.0 by Paul Favors ReviewDiscount And Massive Bonus, SP Influencer 3.0 by Paul Favors ReviewHonest Review, SP Influencer 3.0 by Paul Favors ReviewHow to Buy?, SP Influencer 3.0 by Paul Favors ReviewIs It Worth It?, SP Influencer 3.0 by Paul Favors ReviewMega Bonus, SP Influencer 3.0 by Paul Favors ReviewReview, SP Influencer 3.0 by Paul Favors ReviewReview And Bonus Buy Here, SP Influencer 3.0 by Paul Favors ReviewReview And Bonus Buy With Confidence, SP Influencer 3.0 by Paul Favors ReviewReview And Bonus Do I Really Need it, SP Influencer 3.0 by Paul Favors ReviewShould I buy it?, SP Influencer 3.0 by Paul Favors ReviewWho is thisfor?, SP Influencer 3.0 by Paul Favors Review OTO1, SP Influencer 3.0 by Paul Favors Review OTO2, review SP Influencer 3.0 by Paul Favors Review
json metadata{"tags":["spinfluencer3","bypaulfavors","review"],"links":["https://reviewjvzoo.com/sp-influencer-3-0-by-paul-favors-review-get-all-the-money-churning-email-subscribers-sales-and-clients-youll-ever-need-on-autopilot-using-this-underground-marketing-legends-inspired-nev/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkspinfluencer3
permlinkspinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review
titlespinfluencer 3 bypaulfavors review , SP Influencer 3.0 Review
Transaction InfoBlock #21869704/Trx 5e94ae2ac4b78502cb4155643a78414175e3a390
View Raw JSON Data
{
  "block": 21869704,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "“Getting Off The Ground Is Hard!”\n\nSure, eventually when you stick with it, you can absolutely make it. Thing is, it does take time. It does not happen overnight for anyone. You get so caught up learning all this stuff that it becomes overwhelming. And there are some things that most people don’t really want to do. \n\nListen, you probably already know a lot more than you give yourself credit for. In my own journey I found that certain things are much easier than others. Things like content or copywriting are just plain tough, and totally boring to me. Other things like traffic, are really not that hard. Especially when you have a foolproof system to follow. That’s when I discovered this foolproof system that produced real results for me. Let’s check out my SP Influencer 3.0 Review below for more details!\n\nAfter the success of SP Influencer 2.0 and 1.0, The author created version 3.0 to expand upon the core principles of this newbie friendly course that will have you stuffing your Paypal accounts full of cash almost instantly. \n\nIn a nutshell, SP Influencer 3.0 is a training that shows you how to Get LinkedIn’s TOP influencers promoting your offers absolutely free, sending floods of traffic, opt-ins, sales and much more.\n\nCheck Here :\nhttps://reviewjvzoo.com/sp-influencer-3-0-by-paul-favors-review-get-all-the-money-churning-email-subscribers-sales-and-clients-youll-ever-need-on-autopilot-using-this-underground-marketing-legends-inspired-nev/\n\nTags : SP Influencer 3.0, SP Influencer 3.0 review, Demo SP Influencer 3.0 by Paul Favors Review review, SP Influencer 3.0 by Paul Favors Review, SP Influencer 3.0 by Paul Favors Review- Should you Buy It?, SP Influencer 3.0 by Paul Favors Review- The best prices, SP Influencer 3.0 by Paul Favors ReviewA Quick Peek Inside, SP Influencer 3.0 by Paul Favors ReviewBonus, SP Influencer 3.0 by Paul Favors ReviewBonuses, SP Influencer 3.0 by Paul Favors ReviewBuy, SP Influencer 3.0 by Paul Favors ReviewDiscount And Massive Bonus, SP Influencer 3.0 by Paul Favors ReviewHonest Review, SP Influencer 3.0 by Paul Favors ReviewHow to Buy?, SP Influencer 3.0 by Paul Favors ReviewIs It Worth It?, SP Influencer 3.0 by Paul Favors ReviewMega Bonus, SP Influencer 3.0 by Paul Favors ReviewReview, SP Influencer 3.0 by Paul Favors ReviewReview And Bonus Buy Here, SP Influencer 3.0 by Paul Favors ReviewReview And Bonus Buy With Confidence, SP Influencer 3.0 by Paul Favors ReviewReview And Bonus Do I Really Need it, SP Influencer 3.0 by Paul Favors ReviewShould I buy it?, SP Influencer 3.0 by Paul Favors ReviewWho is thisfor?, SP Influencer 3.0 by Paul Favors Review OTO1, SP Influencer 3.0 by Paul Favors Review OTO2, review SP Influencer 3.0 by Paul Favors Review",
      "json_metadata": "{\"tags\":[\"spinfluencer3\",\"bypaulfavors\",\"review\"],\"links\":[\"https://reviewjvzoo.com/sp-influencer-3-0-by-paul-favors-review-get-all-the-money-churning-email-subscribers-sales-and-clients-youll-ever-need-on-autopilot-using-this-underground-marketing-legends-inspired-nev/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "spinfluencer3",
      "permlink": "spinfluencer-3-bypaulfavors-review-sp-influencer-3-0-review",
      "title": "spinfluencer 3 bypaulfavors review , SP Influencer 3.0 Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T07:23:03",
  "trx_id": "5e94ae2ac4b78502cb4155643a78414175e3a390",
  "trx_in_block": 33,
  "virtual_op": 0
}
2018/04/25 04:17:36
authorsteemitboard
bodyCongratulations @gurureviewer! You have completed some achievement on Steemit and have been rewarded with new badge(s) : [![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/post4day.png)](http://steemitboard.com/@gurureviewer) You published 4 posts in one day Click on any badge to view your own Board of Honor on SteemitBoard. For more information about SteemitBoard, click [here](https://steemit.com/@steemitboard) If you no longer want to receive notifications, reply to this comment with the word `STOP` > Upvote this notification to help all Steemit users. Learn why [here](https://steemit.com/steemitboard/@steemitboard/http-i-cubeupload-com-7ciqeo-png)!
json metadata{"image":["https://steemitboard.com/img/notifications.png"]}
parent authorgurureviewer
parent permlinkoto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review
permlinksteemitboard-notify-gurureviewer-20180425t041738000z
title
Transaction InfoBlock #21866003/Trx 35a76e098b46c9682229b9f0b78c3ce572809d04
View Raw JSON Data
{
  "block": 21866003,
  "op": [
    "comment",
    {
      "author": "steemitboard",
      "body": "Congratulations @gurureviewer! You have completed some achievement on Steemit and have been rewarded with new badge(s) :\n\n[![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/post4day.png)](http://steemitboard.com/@gurureviewer) You published 4 posts in one day\n\nClick on any badge to view your own Board of Honor on SteemitBoard.\nFor more information about SteemitBoard, click [here](https://steemit.com/@steemitboard)\n\nIf you no longer want to receive notifications, reply to this comment with the word `STOP`\n\n> Upvote this notification to help all Steemit users. Learn why [here](https://steemit.com/steemitboard/@steemitboard/http-i-cubeupload-com-7ciqeo-png)!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notifications.png\"]}",
      "parent_author": "gurureviewer",
      "parent_permlink": "oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review",
      "permlink": "steemitboard-notify-gurureviewer-20180425t041738000z",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-25T04:17:36",
  "trx_id": "35a76e098b46c9682229b9f0b78c3ce572809d04",
  "trx_in_block": 53,
  "virtual_op": 0
}
2018/04/24 22:56:45
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkoto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review
permlinkcheetah-re-gururevieweroto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review
title
Transaction InfoBlock #21859603/Trx 0abd5f20568d2f3d8b846bacbe90b12323f17057
View Raw JSON Data
{
  "block": 21859603,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review",
      "permlink": "cheetah-re-gururevieweroto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:56:45",
  "trx_id": "0abd5f20568d2f3d8b846bacbe90b12323f17057",
  "trx_in_block": 37,
  "virtual_op": 0
}
2018/04/24 22:56:42
authorgurureviewer
permlinkoto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21859602/Trx f907f0534fa68fc6617dc9b25aac8ad843f2d481
View Raw JSON Data
{
  "block": 21859602,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:56:42",
  "trx_id": "f907f0534fa68fc6617dc9b25aac8ad843f2d481",
  "trx_in_block": 11,
  "virtual_op": 0
}
2018/04/24 22:56:27
authorgurureviewer
bodyOTO #1 Traffic Victory Case Studies By Stefan Ciancio Review - "Want to Make Money Faster? Copy & Paste Our PERSONAL Case Studies and Watch Over-The-Shoulder as We Make $3,485 + Get Our ADVANCED Training!" OTO #1 Traffic Victory Case Studies is a video training course based on Marc's real life case studies, showing methods that Marc is using to generate 100% free traffic through super easy rankings to bring in passive affiliate marketing commissions. Inside Traffic Victory Case Studies you'll get a completely FREE way of generating passive affiliate income using totally free and passive traffic, creating passive income WITHOUT needing to ever launch a single product. You can get started without any experience, and build your own passive affiliate income. Everything is based on Marc's own business and he has replicated the process many times in different niches. No Product Creation or Launching, No Paid Traffic, No Freelancing, and No Directly Trading Time for Money. The Upgrade OTO #1 Traffic Victory Case Studies is Real Case Studies pack that contains A case studies bundle showing your customers over-the-shoulder some of our best results following the Traffic Victory method. You can copy and paste these ideas to get results FASTER! It will be exposed to a second traffic source as well to help them double their traffic. Here's What You Get inside OTO #1 Traffic Victory Case Studies: 3 x Of Our PERSONAL "Copy & Paste" Case Studies: Watch Us Make $3,485 Right In Front Of You! - (VALUE: $497) Do you want to see us setting up a campaign and making money right in front of you? Watch us as we implement every single step from the "Traffic Victory" method... - See how we choose the niche... Watch us find the best keywords and interests... - Then see exactly how we set up the posts, and apply some other "magic tricks" - And watch us send the traffic to the chosen affiliate offers, and see how they convert, in real time! Check more here : https://reviewjvzoo.com/oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-want-to-make-money-faster-copy-paste-stefan-and-team-personal-case-studies-and-watch-over-the-shoulder-how-they-make-3485-get-th/ Tags : OTO #1 Traffic Victory Case Studies By Stefan Ciancio Review, OTO #1 Traffic Victory Case Studies Review, demo Traffic Victory By Stefan Ciancio review, Traffic Victory review, TrafficVictory, Traffic Victory By Stefan Ciancio review, Traffic Victory By Stefan Ciancio, Download Traffic Victory PRO Training Formula By Stefan Ciancio, Features Traffic Victory PRO Training Formula By Stefan Ciancio, JVzoo Traffic Victory PRO Training Formula By Stefan Ciancio, OTO #1 – Traffic Victory PRO Case Studies Pack Upgrade OTO, OTO #2 – Traffic Victory Done For You Campaign Upgrade OTO, OTO #3 – Traffic Victory Reseller License Upgrade OTO, OTO Upsell Traffic Victory PRO Training Formula By Stefan Ciancio, Review Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory, Traffic Victory Download, Traffic Victory Features, Traffic Victory Jvzoo, Traffic Victory OTO, Traffic Victory OTO Review, Traffic Victory OTO Upsell, Traffic Victory PRO, Traffic Victory PRO Case Study, Traffic Victory PRO OTO, Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory PRO Upsell, Traffic Victory Review, Traffic Victory Upsell, Traffic Victory Upsell Download
json metadata{"tags":["oto1trafficvictorycase","studies","bystefan","ciancio","review"],"links":["https://reviewjvzoo.com/oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-want-to-make-money-faster-copy-paste-stefan-and-team-personal-case-studies-and-watch-over-the-shoulder-how-they-make-3485-get-th/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkoto1trafficvictorycase
permlinkoto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review
titleOTO #1 Traffic Victory Case Studies By Stefan Ciancio Review , OTO #1 Traffic Victory Case Studies Review
Transaction InfoBlock #21859597/Trx 3e65a59babd1f2b3a5f45126768cf2127524b172
View Raw JSON Data
{
  "block": 21859597,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "OTO #1 Traffic Victory Case Studies By Stefan Ciancio Review - \"Want to Make Money Faster? Copy & Paste Our PERSONAL Case Studies and Watch Over-The-Shoulder as We Make $3,485 + Get Our ADVANCED Training!\"\n\nOTO #1 Traffic Victory Case Studies is a video training course based on Marc's real life case studies, showing methods that Marc is using to generate 100% free traffic through super easy rankings to bring in passive affiliate marketing commissions. Inside Traffic Victory Case Studies you'll get a completely FREE way of generating passive affiliate income using totally free and passive traffic, creating passive income WITHOUT needing to ever launch a single product. You can get started without any experience, and build your own passive affiliate income. Everything is based on Marc's own business and he has replicated the process many times in different niches. No Product Creation or Launching, No Paid Traffic, No Freelancing, and No Directly Trading Time for Money. The Upgrade OTO #1 Traffic Victory Case Studies is Real Case Studies pack that contains A case studies bundle showing your customers over-the-shoulder some of our best results following the Traffic Victory method. You can copy and paste these ideas to get results FASTER! It will be exposed to a second traffic source as well to help them double their traffic.\n\nHere's What You Get inside OTO #1 Traffic Victory Case Studies:\n\n3 x Of Our PERSONAL \"Copy & Paste\" Case Studies: Watch Us Make $3,485 Right In Front Of You! - (VALUE: $497)\nDo you want to see us setting up a campaign and making money right in front of you? Watch us as we implement every single step from the \"Traffic Victory\" method...\n\n- See how we choose the niche... Watch us find the best keywords and interests...\n- Then see exactly how we set up the posts, and apply some other \"magic tricks\"\n- And watch us send the traffic to the chosen affiliate offers, and see how they convert, in real time!\n\nCheck more here :\nhttps://reviewjvzoo.com/oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-want-to-make-money-faster-copy-paste-stefan-and-team-personal-case-studies-and-watch-over-the-shoulder-how-they-make-3485-get-th/\n\nTags : OTO #1 Traffic Victory Case Studies By Stefan Ciancio Review, OTO #1 Traffic Victory Case Studies Review, demo Traffic Victory By Stefan Ciancio review, Traffic Victory review, TrafficVictory, Traffic Victory By Stefan Ciancio review, Traffic Victory By Stefan Ciancio, Download Traffic Victory PRO Training Formula By Stefan Ciancio, Features Traffic Victory PRO Training Formula By Stefan Ciancio, JVzoo Traffic Victory PRO Training Formula By Stefan Ciancio, OTO #1 – Traffic Victory PRO Case Studies Pack Upgrade OTO, OTO #2 – Traffic Victory Done For You Campaign Upgrade OTO, OTO #3 – Traffic Victory Reseller License Upgrade OTO, OTO Upsell Traffic Victory PRO Training Formula By Stefan Ciancio, Review Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory, Traffic Victory Download, Traffic Victory Features, Traffic Victory Jvzoo, Traffic Victory OTO, Traffic Victory OTO Review, Traffic Victory OTO Upsell, Traffic Victory PRO, Traffic Victory PRO Case Study, Traffic Victory PRO OTO, Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory PRO Upsell, Traffic Victory Review, Traffic Victory Upsell, Traffic Victory Upsell Download",
      "json_metadata": "{\"tags\":[\"oto1trafficvictorycase\",\"studies\",\"bystefan\",\"ciancio\",\"review\"],\"links\":[\"https://reviewjvzoo.com/oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-want-to-make-money-faster-copy-paste-stefan-and-team-personal-case-studies-and-watch-over-the-shoulder-how-they-make-3485-get-th/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "oto1trafficvictorycase",
      "permlink": "oto-1-traffic-victory-case-studies-by-stefan-ciancio-review-oto-1-traffic-victory-case-studies-review",
      "title": "OTO #1 Traffic Victory Case Studies By Stefan Ciancio Review , OTO #1 Traffic Victory Case Studies Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:56:27",
  "trx_id": "3e65a59babd1f2b3a5f45126768cf2127524b172",
  "trx_in_block": 11,
  "virtual_op": 0
}
2018/04/24 22:52:30
authorgurureviewer
permlinktraffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review
voterblack-man
weight2000 (20.00%)
Transaction InfoBlock #21859519/Trx b294778f28559ad8a3e5eb73e8187ad1e464d538
View Raw JSON Data
{
  "block": 21859519,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "traffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review",
      "voter": "black-man",
      "weight": 2000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:52:30",
  "trx_id": "b294778f28559ad8a3e5eb73e8187ad1e464d538",
  "trx_in_block": 1,
  "virtual_op": 0
}
2018/04/24 22:18:39
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinktraffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review
permlinkcheetah-re-gurureviewertraffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review
title
Transaction InfoBlock #21858844/Trx 404449ee57552c1e81fa253b22e68fcf1a43b62c
View Raw JSON Data
{
  "block": 21858844,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "traffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review",
      "permlink": "cheetah-re-gurureviewertraffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:18:39",
  "trx_id": "404449ee57552c1e81fa253b22e68fcf1a43b62c",
  "trx_in_block": 69,
  "virtual_op": 0
}
2018/04/24 22:18:36
authorgurureviewer
permlinktraffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21858843/Trx 827ee228b685a73f2284f8eb27de76ad73809dc5
View Raw JSON Data
{
  "block": 21858843,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "traffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:18:36",
  "trx_id": "827ee228b685a73f2284f8eb27de76ad73809dc5",
  "trx_in_block": 48,
  "virtual_op": 0
}
2018/04/24 22:18:27
authorgurureviewer
bodyTraffic Victory PRO Training Formula By Stefan Ciancio is Best Training Course, Formula, and Reval Case Study Discover Simple System To Builds Free Traffic Machines that Generate 100% Free Traffic Through Super Easy Rankings and Bring In $100-$200+ Per Day In Passive Affiliate Marketing Commissions. This formula also show you how to set up as many passive traffic machines as you like, with as little as 20-30 minutes per day! Traffic Victory PRO Training Formula is a video training course based on Marc’s real life case studies, showing methods that Marc Gray is using to generate 100% free traffic through super easy rankings to bring in passive affiliate marketing commissions. It combines 100% free, targeted traffic with his powerful affiliate marketing method, giving you the ability to create passive affiliate income campaigns, basically little “machines” that will run in the background for you and collect passive commissions on autopilot. Imagine having a a few of these free traffic machines bringing you targeted, consistent traffic to your affiliate links? And imagine that you can make as many of these free traffic machines as you like and in any niche you want to dominate. Inside traffic victory we will show you a completely free way of generating passive affiliate income using totally free and passive traffic, creating passive income without needing to ever launch a single product. You can get started without any experience, and build their own passive affiliate income. Everything is based on marc’s own business and he has replicated the process many times in different niches. No product creation or launching, no paid traffic, no freelancing and no directly trading time for money. Marc gray will show you how to build your own sustainable online traffic for your affiliate marketing business. Not only will it show you how to set up free, passive traffic in any niche, but it will also show you how to build passive affiliate income with it. CHeck more here : https://reviewjvzoo.com/traffic-victory-by-stefan-ciancio-review-discover-marc-grays-exact-traffic-strategy-to-allow-him-to-get-over-1000-visitors-in-any-niche-at-no-cost-perfect-for-helping-him-rake-in/ Tags : Video Training and tagged Download Traffic Victory PRO Training Formula By Stefan Ciancio, Features Traffic Victory PRO Training Formula By Stefan Ciancio, JVzoo Traffic Victory PRO Training Formula By Stefan Ciancio, OTO #1 – Traffic Victory PRO Case Studies Pack Upgrade OTO, OTO #2 – Traffic Victory Done For You Campaign Upgrade OTO, OTO #3 – Traffic Victory Reseller License Upgrade OTO, OTO Upsell Traffic Victory PRO Training Formula By Stefan Ciancio, Review Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory, Traffic Victory Download, Traffic Victory Features, Traffic Victory Jvzoo, Traffic Victory OTO, Traffic Victory OTO Review, Traffic Victory OTO Upsell, Traffic Victory PRO, Traffic Victory PRO Case Study, Traffic Victory PRO OTO, Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory PRO Upsell, Traffic Victory Review, Traffic Victory Upsell, Traffic Victory Upsell Download
json metadata{"tags":["trafficvictory","bystefanciancio","review","trafficvictoryreview"],"links":["https://reviewjvzoo.com/traffic-victory-by-stefan-ciancio-review-discover-marc-grays-exact-traffic-strategy-to-allow-him-to-get-over-1000-visitors-in-any-niche-at-no-cost-perfect-for-helping-him-rake-in/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinktrafficvictory
permlinktraffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review
titleTraffic Victory PRO Training Formula By Stefan Ciancio , Traffic Victory By Stefan Ciancio Review
Transaction InfoBlock #21858840/Trx 686b6edd40805df4f1c76dc5209ee9dc9f394f3d
View Raw JSON Data
{
  "block": 21858840,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Traffic Victory PRO Training Formula By Stefan Ciancio is Best Training Course, Formula, and Reval Case Study Discover Simple System To Builds Free Traffic Machines that Generate 100% Free Traffic Through Super Easy Rankings and Bring In $100-$200+ Per Day In Passive Affiliate Marketing Commissions. This formula also show you how to set up as many passive traffic machines as you like, with as little as 20-30 minutes per day! \n\nTraffic Victory PRO Training Formula is a video training course based on Marc’s real life case studies, showing methods that Marc Gray is using to generate 100% free traffic through super easy rankings to bring in passive affiliate marketing commissions. It combines 100% free, targeted traffic with his powerful affiliate marketing method, giving you the ability to create passive affiliate income campaigns, basically little “machines” that will run in the background for you and collect passive commissions on autopilot. Imagine having a a few of these free traffic machines bringing you targeted, consistent traffic to your affiliate links? And imagine that you can make as many of these free traffic machines as you like and in any niche you want to dominate. Inside traffic victory we will show you a completely free way of generating passive affiliate income using totally free and passive traffic, creating passive income without needing to ever launch a single product. You can get started without any experience, and build their own passive affiliate income. Everything is based on marc’s own business and he has replicated the process many times in different niches. No product creation or launching, no paid traffic, no freelancing and no directly trading time for money. Marc gray will show you how to build your own sustainable online traffic for your affiliate marketing business. Not only will it show you how to set up free, passive traffic in any niche, but it will also show you how to build passive affiliate income with it. \n\nCHeck more here :\nhttps://reviewjvzoo.com/traffic-victory-by-stefan-ciancio-review-discover-marc-grays-exact-traffic-strategy-to-allow-him-to-get-over-1000-visitors-in-any-niche-at-no-cost-perfect-for-helping-him-rake-in/\n\nTags : Video Training and tagged Download Traffic Victory PRO Training Formula By Stefan Ciancio, Features Traffic Victory PRO Training Formula By Stefan Ciancio, JVzoo Traffic Victory PRO Training Formula By Stefan Ciancio, OTO #1 – Traffic Victory PRO Case Studies Pack Upgrade OTO, OTO #2 – Traffic Victory Done For You Campaign Upgrade OTO, OTO #3 – Traffic Victory Reseller License Upgrade OTO, OTO Upsell Traffic Victory PRO Training Formula By Stefan Ciancio, Review Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory, Traffic Victory Download, Traffic Victory Features, Traffic Victory Jvzoo, Traffic Victory OTO, Traffic Victory OTO Review, Traffic Victory OTO Upsell, Traffic Victory PRO, Traffic Victory PRO Case Study, Traffic Victory PRO OTO, Traffic Victory PRO Training Formula By Stefan Ciancio, Traffic Victory PRO Upsell, Traffic Victory Review, Traffic Victory Upsell, Traffic Victory Upsell Download",
      "json_metadata": "{\"tags\":[\"trafficvictory\",\"bystefanciancio\",\"review\",\"trafficvictoryreview\"],\"links\":[\"https://reviewjvzoo.com/traffic-victory-by-stefan-ciancio-review-discover-marc-grays-exact-traffic-strategy-to-allow-him-to-get-over-1000-visitors-in-any-niche-at-no-cost-perfect-for-helping-him-rake-in/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "trafficvictory",
      "permlink": "traffic-victory-pro-training-formula-by-stefan-ciancio-traffic-victory-by-stefan-ciancio-review",
      "title": "Traffic Victory PRO Training Formula By Stefan Ciancio , Traffic Victory By Stefan Ciancio Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T22:18:27",
  "trx_id": "686b6edd40805df4f1c76dc5209ee9dc9f394f3d",
  "trx_in_block": 15,
  "virtual_op": 0
}
2018/04/24 15:20:42
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinkaudio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review
permlinkcheetah-re-gururevieweraudio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review
title
Transaction InfoBlock #21850531/Trx 5e0c4caaf481bf1e1e92ff4b4c028b371f5a407f
View Raw JSON Data
{
  "block": 21850531,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "audio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review",
      "permlink": "cheetah-re-gururevieweraudio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T15:20:42",
  "trx_id": "5e0c4caaf481bf1e1e92ff4b4c028b371f5a407f",
  "trx_in_block": 22,
  "virtual_op": 0
}
2018/04/24 15:20:33
authorgurureviewer
permlinkaudio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review
votercheetah
weight-8 (-0.08%)
Transaction InfoBlock #21850528/Trx 4960deaf770089efdeca872bbb97be517ae553ab
View Raw JSON Data
{
  "block": 21850528,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "audio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review",
      "voter": "cheetah",
      "weight": -8
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T15:20:33",
  "trx_id": "4960deaf770089efdeca872bbb97be517ae553ab",
  "trx_in_block": 3,
  "virtual_op": 0
}
2018/04/24 15:20:18
authorgurureviewer
bodyAudio Video Mastery by Athanasios Hatzikirkou Review - Discover How You Too Can Create Audio And Video Productions Like a "Pro", Fast And Easy That Converts With Results! Over the last 20 years, Attan has created over 20,000 radio and video commercials so he knows a thing or two about audio and video production! Now, out of the blue, he is offering his knowledge in this step-by-step “How to” audio/video course “Audio/Video Mastery” This is training straight from a professional via a 10 module video course which offers exceptional value. Attan teaches everything required to enhance your audio and video productions and take them to a level where they will stand out from the crowd. For instance, I haven't seen such detailed lessons about audio enhancement included in any of the courses I've seen previously. This alone makes it worth grabbing “Audio/Video Mastery” in my opinion. The course consists of a range of 10 video tutorial modules covering every topic in detail. You just follow along as Attan demonstrates each technique with over-theshoulder instructions. Modules include, “how to make your video sound like a pro”, “how to produce the perfect tutorial video”, “how to create ready made animation templates” and a whole lot more. For me, the standout feature of “Audio/Video Mastery” is it's exceptional value for money and I would have no hesitation in recommending it to anyone. Inside Audio Video Mastery, You’ll Discover… - How to get started with Audio Video Mastery today, even if you’re a total newbie and have no skills, and no experience right now. - How to 10X your sound in your video productions..Totally FREE! - The simple steps to take royalty free photos and video footage and making a complete ready made production. I’ll show you EXACTLY how to do everything the right way, - How to create a Youtube video with intro, outro, animations, sound fx and even engagement tips. - How to create a solid tutorial video within minutes . I'll show you everything from getting started to a ready made production. - The simple process to make ready made animation templates. The power of having those right setup to save your self countless hours. - The little-known trick to make a Video Sales Letter the fastest way. - Plus, a whole lot more... Check more here : https://reviewjvzoo.com/audio-video-mastery-by-athanasios-hatzikirkou-review-discover-how-you-too-can-create-audio-and-video-productions-like-a-pro-fast-and-easy-that-converts-with-results/ Tags : Demo Audio Video Mastery by Athanasios Hatzikirkou review, Audio Video Mastery by Athanasios Hatzikirkou, Audio Video Mastery by Athanasios Hatzikirkou- Should you Buy It?, Audio Video Mastery by Athanasios Hatzikirkou- The best prices, Audio Video Mastery by Athanasios HatzikirkouA Quick Peek Inside, Audio Video Mastery by Athanasios HatzikirkouBonus, Audio Video Mastery by Athanasios HatzikirkouBonuses, Audio Video Mastery by Athanasios HatzikirkouBuy, Audio Video Mastery by Athanasios HatzikirkouDiscount And Massive Bonus, Audio Video Mastery by Athanasios HatzikirkouHonest Review, Audio Video Mastery by Athanasios HatzikirkouHow to Buy?, Audio Video Mastery by Athanasios HatzikirkouIs It Worth It?, Audio Video Mastery by Athanasios HatzikirkouMega Bonus, Audio Video Mastery by Athanasios HatzikirkouReview, Audio Video Mastery by Athanasios HatzikirkouReview And Bonus Buy Here, Audio Video Mastery by Athanasios HatzikirkouReview And Bonus Buy With Confidence, Audio Video Mastery by Athanasios HatzikirkouReview And Bonus Do I Really Need it, Audio Video Mastery by Athanasios HatzikirkouShould I buy it?, Audio Video Mastery by Athanasios HatzikirkouWho is thisfor?, Audio Video Mastery by Athanasios Hatzikirkou OTO1, Audio Video Mastery by Athanasios Hatzikirkou OTO2, review Audio Video Mastery by Athanasios Hatzikirkou
json metadata{"tags":["audiovideomastery","byathanasioshatzikirkou","review","audiovideomasteryreview"],"links":["https://reviewjvzoo.com/audio-video-mastery-by-athanasios-hatzikirkou-review-discover-how-you-too-can-create-audio-and-video-productions-like-a-pro-fast-and-easy-that-converts-with-results/"],"app":"steemit/0.1","format":"markdown"}
parent author
parent permlinkaudiovideomastery
permlinkaudio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review
titleAudio Video Mastery by Athanasios Hatzikirkou Review , Audio Video Mastery Review
Transaction InfoBlock #21850523/Trx b8d0d36559275ad3351cde0ec44f4c3798b6fb37
View Raw JSON Data
{
  "block": 21850523,
  "op": [
    "comment",
    {
      "author": "gurureviewer",
      "body": "Audio Video Mastery by Athanasios Hatzikirkou Review - Discover How You Too Can Create Audio And Video Productions Like a \"Pro\", Fast And Easy That Converts With Results!\n \nOver the last 20 years, Attan has created over 20,000 radio and video commercials so he knows a thing or two about audio and video production! Now, out of the blue, he is offering his knowledge in this step-by-step “How to” audio/video course “Audio/Video Mastery” This is training straight from a professional via a 10 module video course which offers exceptional value. Attan teaches everything required to enhance your audio and video productions and take them to a level where they will stand out from the crowd. For instance, I haven't seen such detailed lessons about audio enhancement included in any of the courses I've seen previously. This alone makes it worth grabbing “Audio/Video Mastery” in my opinion. The course consists of a range of 10 video tutorial modules covering every topic in detail. You just follow along as Attan demonstrates each technique with over-theshoulder instructions. Modules include, “how to make your video sound like a pro”, “how to produce the perfect tutorial video”, “how to create ready made animation templates” and a whole lot more. For me, the standout feature of “Audio/Video Mastery” is it's exceptional value for money and I would have no hesitation in recommending it to anyone. \n\nInside Audio Video Mastery,  You’ll Discover…\n\n- How to get started with Audio Video Mastery today, even if you’re a total newbie and have no skills, and no experience right now.\n- How to 10X your sound in your video productions..Totally FREE!\n- The simple steps to take royalty free photos and video footage and making a complete ready made production. I’ll show you EXACTLY how to do everything the right way, \n- How to create a Youtube video with intro, outro, animations, sound fx and even engagement tips.\n- How to create a solid tutorial video within minutes . I'll show you everything from getting started to a ready made production.\n- The simple process to make ready made animation templates. The power of having those right setup to save your self countless hours.\n- The little-known trick to make a Video Sales Letter the fastest way.\n- Plus, a whole lot more...\n\nCheck more here :\nhttps://reviewjvzoo.com/audio-video-mastery-by-athanasios-hatzikirkou-review-discover-how-you-too-can-create-audio-and-video-productions-like-a-pro-fast-and-easy-that-converts-with-results/\n\nTags : Demo Audio Video Mastery by Athanasios Hatzikirkou review, Audio Video Mastery by Athanasios Hatzikirkou, Audio Video Mastery by Athanasios Hatzikirkou- Should you Buy It?, Audio Video Mastery by Athanasios Hatzikirkou- The best prices, Audio Video Mastery by Athanasios HatzikirkouA Quick Peek Inside, Audio Video Mastery by Athanasios HatzikirkouBonus, Audio Video Mastery by Athanasios HatzikirkouBonuses, Audio Video Mastery by Athanasios HatzikirkouBuy, Audio Video Mastery by Athanasios HatzikirkouDiscount And Massive Bonus, Audio Video Mastery by Athanasios HatzikirkouHonest Review, Audio Video Mastery by Athanasios HatzikirkouHow to Buy?, Audio Video Mastery by Athanasios HatzikirkouIs It Worth It?, Audio Video Mastery by Athanasios HatzikirkouMega Bonus, Audio Video Mastery by Athanasios HatzikirkouReview, Audio Video Mastery by Athanasios HatzikirkouReview And Bonus Buy Here, Audio Video Mastery by Athanasios HatzikirkouReview And Bonus Buy With Confidence, Audio Video Mastery by Athanasios HatzikirkouReview And Bonus Do I Really Need it, Audio Video Mastery by Athanasios HatzikirkouShould I buy it?, Audio Video Mastery by Athanasios HatzikirkouWho is thisfor?, Audio Video Mastery by Athanasios Hatzikirkou OTO1, Audio Video Mastery by Athanasios Hatzikirkou OTO2, review Audio Video Mastery by Athanasios Hatzikirkou",
      "json_metadata": "{\"tags\":[\"audiovideomastery\",\"byathanasioshatzikirkou\",\"review\",\"audiovideomasteryreview\"],\"links\":[\"https://reviewjvzoo.com/audio-video-mastery-by-athanasios-hatzikirkou-review-discover-how-you-too-can-create-audio-and-video-productions-like-a-pro-fast-and-easy-that-converts-with-results/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}",
      "parent_author": "",
      "parent_permlink": "audiovideomastery",
      "permlink": "audio-video-mastery-by-athanasios-hatzikirkou-review-audio-video-mastery-review",
      "title": "Audio Video Mastery by Athanasios Hatzikirkou Review , Audio Video Mastery Review"
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T15:20:18",
  "trx_id": "b8d0d36559275ad3351cde0ec44f4c3798b6fb37",
  "trx_in_block": 3,
  "virtual_op": 0
}
2018/04/24 10:19:48
authorcheetah
bodyWarning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post! To get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).
json metadata
parent authorgurureviewer
parent permlinksocial-proof-tactics-by-kam-jennings-review-socialprooftacticsreview
permlinkcheetah-re-gurureviewersocial-proof-tactics-by-kam-jennings-review-socialprooftacticsreview
title
Transaction InfoBlock #21844541/Trx 182206d7d64935181deb6ff8a9299db36274d89a
View Raw JSON Data
{
  "block": 21844541,
  "op": [
    "comment",
    {
      "author": "cheetah",
      "body": "Warning! This user is on my black list, likely as a known plagiarist, spammer or ID thief. Please be cautious with this post!\nTo get off this list, please chat with us in the #steemitabuse-appeals channel in [steemit.chat](http://steemit.chat).",
      "json_metadata": "",
      "parent_author": "gurureviewer",
      "parent_permlink": "social-proof-tactics-by-kam-jennings-review-socialprooftacticsreview",
      "permlink": "cheetah-re-gurureviewersocial-proof-tactics-by-kam-jennings-review-socialprooftacticsreview",
      "title": ""
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T10:19:48",
  "trx_id": "182206d7d64935181deb6ff8a9299db36274d89a",
  "trx_in_block": 26,
  "virtual_op": 0
}
2018/04/24 10:16:48
authorgurureviewer
permlinksocial-proof-tactics-by-kam-jennings-review-socialprooftacticsreview
votergurureviewer
weight10000 (100.00%)
Transaction InfoBlock #21844481/Trx 49949c12ea73d718b6144bcf630909cd06d69c1c
View Raw JSON Data
{
  "block": 21844481,
  "op": [
    "vote",
    {
      "author": "gurureviewer",
      "permlink": "social-proof-tactics-by-kam-jennings-review-socialprooftacticsreview",
      "voter": "gurureviewer",
      "weight": 10000
    }
  ],
  "op_in_trx": 0,
  "timestamp": "2018-04-24T10:16:48",
  "trx_id": "49949c12ea73d718b6144bcf630909cd06d69c1c",
  "trx_in_block": 14,
  "virtual_op": 0
}

Account Metadata

POSTING JSON METADATA
profile{"profile_image":"http://gurureviewer.com/wp-content/uploads/2016/04/das-1.jpg","name":"gurureviewer","website":"http://gurureviewer.com/"}
JSON METADATA
profile{"profile_image":"http://gurureviewer.com/wp-content/uploads/2016/04/das-1.jpg","name":"gurureviewer","website":"http://gurureviewer.com/"}
{
  "posting_json_metadata": {
    "profile": {
      "profile_image": "http://gurureviewer.com/wp-content/uploads/2016/04/das-1.jpg",
      "name": "gurureviewer",
      "website": "http://gurureviewer.com/"
    }
  },
  "json_metadata": {
    "profile": {
      "profile_image": "http://gurureviewer.com/wp-content/uploads/2016/04/das-1.jpg",
      "name": "gurureviewer",
      "website": "http://gurureviewer.com/"
    }
  }
}

Auth Keys

Owner
Single Signature
Public Keys
STM81N7SUdAeaGqFiHU4eJzG96zA5qQPc8Gjcqa64f5xP1bA3qiF31/1
Active
Single Signature
Public Keys
STM8ZgMSMUjxntUcsAFaiLFyTgD6Qt5fhXkgAZfnmbf9BqqPmrCw51/1
Posting
Single Signature
Public Keys
STM8aF767vAyCF1uhBt62fNi2oFisdMB8itLFy6E1PUBsTs2TWyFN1/1
Memo
STM5i2C3V7KkMphnEUkg1hR6EDvgv152f19AhetDAK2ofKoQmLxDy
{
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM81N7SUdAeaGqFiHU4eJzG96zA5qQPc8Gjcqa64f5xP1bA3qiF3",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8ZgMSMUjxntUcsAFaiLFyTgD6Qt5fhXkgAZfnmbf9BqqPmrCw5",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8aF767vAyCF1uhBt62fNi2oFisdMB8itLFy6E1PUBsTs2TWyFN",
        1
      ]
    ]
  },
  "memo": "STM5i2C3V7KkMphnEUkg1hR6EDvgv152f19AhetDAK2ofKoQmLxDy"
}

Witness Votes

0 / 30
No active witness votes.
[]