Ecoer Logo

@earthempaths

31

The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.

steemit.com/@earthempaths
VOTING POWER100.00%
DOWNVOTE POWER100.00%
RESOURCE CREDITS100.00%
REPUTATION PROGRESS90.14%
Net Worth
0.340USD
STEEM
0.003STEEM
SBD
0.600SBD
Effective Power
5.001SP
├── Own SP
0.809SP
└── Incoming Deleg
+4.192SP

Detailed Balance

STEEM
balance
0.003STEEM
market_balance
0.000STEEM
savings_balance
0.000STEEM
reward_steem_balance
0.000STEEM
STEEM POWER
Own SP
0.809SP
Delegated Out
0.000SP
Delegation In
4.192SP
Effective Power
5.001SP
Reward SP (pending)
0.052SP
SBD
sbd_balance
0.464SBD
sbd_conversions
0.000SBD
sbd_market_balance
0.000SBD
savings_sbd_balance
0.000SBD
reward_sbd_balance
0.136SBD
{
  "balance": "0.003 STEEM",
  "savings_balance": "0.000 STEEM",
  "reward_steem_balance": "0.000 STEEM",
  "vesting_shares": "1317.342013 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "6826.317793 VESTS",
  "sbd_balance": "0.464 SBD",
  "savings_sbd_balance": "0.000 SBD",
  "reward_sbd_balance": "0.136 SBD",
  "conversions": []
}

Account Info

nameearthempaths
id400826
rank543,229
reputation4525971665
created2017-10-07T18:12:03
recovery_accountsteem
proxyNone
post_count52
comment_count0
lifetime_vote_count0
witnesses_voted_for0
last_post2018-05-31T18:05:24
last_root_post2018-05-31T18:05:24
last_vote_time2018-09-26T23:49:36
proxied_vsf_votes0, 0, 0, 0
can_vote1
voting_power0
delayed_votes0
balance0.003 STEEM
savings_balance0.000 STEEM
sbd_balance0.464 SBD
savings_sbd_balance0.000 SBD
vesting_shares1317.342013 VESTS
delegated_vesting_shares0.000000 VESTS
received_vesting_shares6826.317793 VESTS
reward_vesting_balance105.748159 VESTS
vesting_balance0.000 STEEM
vesting_withdraw_rate0.000000 VESTS
next_vesting_withdrawal1969-12-31T23:59:59
withdrawn0
to_withdraw0
withdraw_routes0
savings_withdraw_requests0
last_account_recovery1970-01-01T00:00:00
reset_accountnull
last_owner_update1970-01-01T00:00:00
last_account_update2018-01-23T21:36:15
minedNo
sbd_seconds0
sbd_last_interest_payment2018-05-26T13:21:57
savings_sbd_last_interest_payment1970-01-01T00:00:00
{
  "id": 400826,
  "name": "earthempaths",
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM6zGjqzr2xWa5bRAkahE8goVCdMUwMpRSNmBdiemVfYeZEfWpPM",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8mW8pm42ZxGB5ckRcug7awAFbeqCFgjYeRthX52qJXZUNcRxmG",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [
      [
        "dtube.app",
        1
      ]
    ],
    "key_auths": [
      [
        "STM5dDjnwPiV39RxLd7gzXnLydTREo2EPk7a4s77BXFMB3hTp4Pd6",
        1
      ]
    ]
  },
  "memo_key": "STM5cnNbWwqq2HxxK8TEBHXyLh32uxYv1ZSvT5uaRBvgJAZiNb13Z",
  "json_metadata": "{\"profile\":{\"profile_image\":\"http://earthempaths.net/forum/phpBB3/download/file.php?avatar=50_1424445185.jpg\",\"cover_image\":\"http://earthempaths.net/wp/wp-content/uploads/2018/01/Reflecting-light-and-chair.jpg\",\"name\":\"Earth Empaths\",\"about\":\"The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.\",\"location\":\"Mother Earth\",\"website\":\"http://earthempaths.net/wp/\"}}",
  "posting_json_metadata": "{\"profile\":{\"profile_image\":\"http://earthempaths.net/forum/phpBB3/download/file.php?avatar=50_1424445185.jpg\",\"cover_image\":\"http://earthempaths.net/wp/wp-content/uploads/2018/01/Reflecting-light-and-chair.jpg\",\"name\":\"Earth Empaths\",\"about\":\"The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.\",\"location\":\"Mother Earth\",\"website\":\"http://earthempaths.net/wp/\"}}",
  "proxy": "",
  "last_owner_update": "1970-01-01T00:00:00",
  "last_account_update": "2018-01-23T21:36:15",
  "created": "2017-10-07T18:12:03",
  "mined": false,
  "recovery_account": "steem",
  "last_account_recovery": "1970-01-01T00:00:00",
  "reset_account": "null",
  "comment_count": 0,
  "lifetime_vote_count": 0,
  "post_count": 52,
  "can_vote": true,
  "voting_manabar": {
    "current_mana": "8143659806",
    "last_update_time": 1779061641
  },
  "downvote_manabar": {
    "current_mana": 2035914951,
    "last_update_time": 1779061641
  },
  "voting_power": 0,
  "balance": "0.003 STEEM",
  "savings_balance": "0.000 STEEM",
  "sbd_balance": "0.464 SBD",
  "sbd_seconds": "0",
  "sbd_seconds_last_update": "2018-05-26T13:21:57",
  "sbd_last_interest_payment": "2018-05-26T13:21:57",
  "savings_sbd_balance": "0.000 SBD",
  "savings_sbd_seconds": "0",
  "savings_sbd_seconds_last_update": "1970-01-01T00:00:00",
  "savings_sbd_last_interest_payment": "1970-01-01T00:00:00",
  "savings_withdraw_requests": 0,
  "reward_sbd_balance": "0.136 SBD",
  "reward_steem_balance": "0.000 STEEM",
  "reward_vesting_balance": "105.748159 VESTS",
  "reward_vesting_steem": "0.052 STEEM",
  "vesting_shares": "1317.342013 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "6826.317793 VESTS",
  "vesting_withdraw_rate": "0.000000 VESTS",
  "next_vesting_withdrawal": "1969-12-31T23:59:59",
  "withdrawn": 0,
  "to_withdraw": 0,
  "withdraw_routes": 0,
  "curation_rewards": 9,
  "posting_rewards": 358,
  "proxied_vsf_votes": [
    0,
    0,
    0,
    0
  ],
  "witnesses_voted_for": 0,
  "last_post": "2018-05-31T18:05:24",
  "last_root_post": "2018-05-31T18:05:24",
  "last_vote_time": "2018-09-26T23:49:36",
  "post_bandwidth": 0,
  "pending_claimed_accounts": 0,
  "vesting_balance": "0.000 STEEM",
  "reputation": "4525971665",
  "transfer_history": [],
  "market_history": [],
  "post_history": [],
  "vote_history": [],
  "other_history": [],
  "witness_votes": [],
  "tags_usage": [],
  "guest_bloggers": [],
  "rank": 543229
}

Withdraw Routes

IncomingOutgoing
Empty
Empty
{
  "incoming": [],
  "outgoing": []
}
From Date
To Date
steemdelegated 4.192 SP to @earthempaths
2026/05/17 23:47:21
delegatorsteem
delegateeearthempaths
vesting shares6826.317793 VESTS
Transaction InfoBlock #106142894/Trx 2fef0507a4cbd2e8326dd2b73b29658f1bb1ee4d
View Raw JSON Data
{
  "trx_id": "2fef0507a4cbd2e8326dd2b73b29658f1bb1ee4d",
  "block": 106142894,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2026-05-17T23:47:21",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "6826.317793 VESTS"
    }
  ]
}
steemdelegated 2.526 SP to @earthempaths
2026/05/12 01:56:24
delegatorsteem
delegateeearthempaths
vesting shares4114.107388 VESTS
Transaction InfoBlock #105973431/Trx 8d0256074e4d256bc9f0603ee6f627e103f2a178
View Raw JSON Data
{
  "trx_id": "8d0256074e4d256bc9f0603ee6f627e103f2a178",
  "block": 105973431,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2026-05-12T01:56:24",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "4114.107388 VESTS"
    }
  ]
}
steemdelegated 4.200 SP to @earthempaths
2026/04/25 23:08:57
delegatorsteem
delegateeearthempaths
vesting shares6838.833549 VESTS
Transaction InfoBlock #105510557/Trx d3d541b0c055b5cc5c198cda199acf982ed11d63
View Raw JSON Data
{
  "trx_id": "d3d541b0c055b5cc5c198cda199acf982ed11d63",
  "block": 105510557,
  "trx_in_block": 7,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2026-04-25T23:08:57",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "6838.833549 VESTS"
    }
  ]
}
steemdelegated 2.552 SP to @earthempaths
2026/01/23 06:32:27
delegatorsteem
delegateeearthempaths
vesting shares4155.654207 VESTS
Transaction InfoBlock #102850298/Trx 631fbac854cb45d452f46bc4b03a5c0ccbb1a23a
View Raw JSON Data
{
  "trx_id": "631fbac854cb45d452f46bc4b03a5c0ccbb1a23a",
  "block": 102850298,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2026-01-23T06:32:27",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "4155.654207 VESTS"
    }
  ]
}
steemdelegated 2.653 SP to @earthempaths
2024/12/17 01:51:57
delegatorsteem
delegateeearthempaths
vesting shares4319.873404 VESTS
Transaction InfoBlock #91296717/Trx 0523a04f45220a65acea7191cdf688d2d196bcd1
View Raw JSON Data
{
  "trx_id": "0523a04f45220a65acea7191cdf688d2d196bcd1",
  "block": 91296717,
  "trx_in_block": 1,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2024-12-17T01:51:57",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "4319.873404 VESTS"
    }
  ]
}
steemdelegated 2.757 SP to @earthempaths
2023/11/13 17:34:48
delegatorsteem
delegateeearthempaths
vesting shares4489.006936 VESTS
Transaction InfoBlock #79850921/Trx 44460e4ce011fbc75807164589219ad6745334a4
View Raw JSON Data
{
  "trx_id": "44460e4ce011fbc75807164589219ad6745334a4",
  "block": 79850921,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2023-11-13T17:34:48",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "4489.006936 VESTS"
    }
  ]
}
steemdelegated 4.560 SP to @earthempaths
2023/09/21 21:16:36
delegatorsteem
delegateeearthempaths
vesting shares7426.285722 VESTS
Transaction InfoBlock #78347165/Trx 94f411b29ac6ddd1e4c97e735bfb8546237dca6f
View Raw JSON Data
{
  "trx_id": "94f411b29ac6ddd1e4c97e735bfb8546237dca6f",
  "block": 78347165,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2023-09-21T21:16:36",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "7426.285722 VESTS"
    }
  ]
}
steemdelegated 4.697 SP to @earthempaths
2022/11/03 11:08:45
delegatorsteem
delegateeearthempaths
vesting shares7647.967160 VESTS
Transaction InfoBlock #69112597/Trx 7984f86a33f294f97162b427738c407c5fdc8941
View Raw JSON Data
{
  "trx_id": "7984f86a33f294f97162b427738c407c5fdc8941",
  "block": 69112597,
  "trx_in_block": 1,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2022-11-03T11:08:45",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "7647.967160 VESTS"
    }
  ]
}
steemdelegated 4.832 SP to @earthempaths
2022/01/17 10:27:21
delegatorsteem
delegateeearthempaths
vesting shares7868.500391 VESTS
Transaction InfoBlock #60808815/Trx 90d8a5ddc9ec7e8fba83bded8d8dc8fe4c44cbe5
View Raw JSON Data
{
  "trx_id": "90d8a5ddc9ec7e8fba83bded8d8dc8fe4c44cbe5",
  "block": 60808815,
  "trx_in_block": 30,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2022-01-17T10:27:21",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "7868.500391 VESTS"
    }
  ]
}
steemdelegated 4.945 SP to @earthempaths
2021/06/14 00:23:51
delegatorsteem
delegateeearthempaths
vesting shares8052.269049 VESTS
Transaction InfoBlock #54607228/Trx 1818065361f0839c4c440856689b1568ce9a376c
View Raw JSON Data
{
  "trx_id": "1818065361f0839c4c440856689b1568ce9a376c",
  "block": 54607228,
  "trx_in_block": 8,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2021-06-14T00:23:51",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8052.269049 VESTS"
    }
  ]
}
steemdelegated 5.060 SP to @earthempaths
2020/12/11 10:43:42
delegatorsteem
delegateeearthempaths
vesting shares8239.691023 VESTS
Transaction InfoBlock #49354712/Trx fb3a223305afb6e39b2f822ed8db1286637239b3
View Raw JSON Data
{
  "trx_id": "fb3a223305afb6e39b2f822ed8db1286637239b3",
  "block": 49354712,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-12-11T10:43:42",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8239.691023 VESTS"
    }
  ]
}
steemdelegated 1.174 SP to @earthempaths
2020/12/06 04:20:57
delegatorsteem
delegateeearthempaths
vesting shares1912.543513 VESTS
Transaction InfoBlock #49206278/Trx 59bb3dd9aa5dcf2a19860763c405dd59ee94f134
View Raw JSON Data
{
  "trx_id": "59bb3dd9aa5dcf2a19860763c405dd59ee94f134",
  "block": 49206278,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-12-06T04:20:57",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "1912.543513 VESTS"
    }
  ]
}
steemdelegated 5.064 SP to @earthempaths
2020/12/05 14:21:54
delegatorsteem
delegateeearthempaths
vesting shares8245.898877 VESTS
Transaction InfoBlock #49189811/Trx 00ea94a7a0ac83aeead8c541f405a6b646739bc0
View Raw JSON Data
{
  "trx_id": "00ea94a7a0ac83aeead8c541f405a6b646739bc0",
  "block": 49189811,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-12-05T14:21:54",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8245.898877 VESTS"
    }
  ]
}
steemdelegated 1.179 SP to @earthempaths
2020/11/02 14:43:15
delegatorsteem
delegateeearthempaths
vesting shares1920.017158 VESTS
Transaction InfoBlock #48256716/Trx 45c642b97dd9b91a2cdd013279187c4e0ffa4693
View Raw JSON Data
{
  "trx_id": "45c642b97dd9b91a2cdd013279187c4e0ffa4693",
  "block": 48256716,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-11-02T14:43:15",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "1920.017158 VESTS"
    }
  ]
}
steemdelegated 5.188 SP to @earthempaths
2020/05/09 05:17:39
delegatorsteem
delegateeearthempaths
vesting shares8448.704236 VESTS
Transaction InfoBlock #43216513/Trx 1e29b0b84954ce3ed3d173e89e74bda847da6e81
View Raw JSON Data
{
  "trx_id": "1e29b0b84954ce3ed3d173e89e74bda847da6e81",
  "block": 43216513,
  "trx_in_block": 14,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-05-09T05:17:39",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8448.704236 VESTS"
    }
  ]
}
steemdelegated 1.200 SP to @earthempaths
2020/05/08 08:49:36
delegatorsteem
delegateeearthempaths
vesting shares1953.311140 VESTS
Transaction InfoBlock #43192529/Trx 8a4c58f8be30659ad687f49a1cec80eb9eb4b581
View Raw JSON Data
{
  "trx_id": "8a4c58f8be30659ad687f49a1cec80eb9eb4b581",
  "block": 43192529,
  "trx_in_block": 9,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-05-08T08:49:36",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "1953.311140 VESTS"
    }
  ]
}
steemdelegated 5.243 SP to @earthempaths
2019/11/29 13:04:57
delegatorsteem
delegateeearthempaths
vesting shares8538.430786 VESTS
Transaction InfoBlock #38599332/Trx 7370493fc5aee15547af34af26a1933789447e1b
View Raw JSON Data
{
  "trx_id": "7370493fc5aee15547af34af26a1933789447e1b",
  "block": 38599332,
  "trx_in_block": 28,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-11-29T13:04:57",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8538.430786 VESTS"
    }
  ]
}
2019/10/07 19:40:54
parent authorearthempaths
parent permlinknarcissism-or-the-introvert-the-covert-and-the-overt
authorsteemitboard
permlinksteemitboard-notify-earthempaths-20191007t194053000z
title
bodyCongratulations @earthempaths! You received a personal award! <table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@earthempaths/birthday2.png</td><td>Happy Birthday! - You are on the Steem blockchain for 2 years!</td></tr></table> <sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@earthempaths) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=earthempaths)_</sub> **Do not miss the last post from @steemitboard:** <table><tr><td><a href="https://steemit.com/steemfest/@steemitboard/the-new-steemfest-badge-is-ready"><img src="https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmRUkELn2Fd13pWFkmWU2wBMMx39EBX5V3cHBEZ2d7f3Ve/image.png"></a></td><td><a href="https://steemit.com/steemfest/@steemitboard/the-new-steemfest-badge-is-ready">The new SteemFest⁴ badge is ready</a></td></tr></table> ###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #37083822/Trx b733046fe9b867340cb256fb73026ac03ec3a058
View Raw JSON Data
{
  "trx_id": "b733046fe9b867340cb256fb73026ac03ec3a058",
  "block": 37083822,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-10-07T19:40:54",
  "op": [
    "comment",
    {
      "parent_author": "earthempaths",
      "parent_permlink": "narcissism-or-the-introvert-the-covert-and-the-overt",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-earthempaths-20191007t194053000z",
      "title": "",
      "body": "Congratulations @earthempaths! You received a personal award!\n\n<table><tr><td>https://steemitimages.com/70x70/http://steemitboard.com/@earthempaths/birthday2.png</td><td>Happy Birthday! - You are on the Steem blockchain for 2 years!</td></tr></table>\n\n<sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@earthempaths) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=earthempaths)_</sub>\n\n\n**Do not miss the last post from @steemitboard:**\n<table><tr><td><a href=\"https://steemit.com/steemfest/@steemitboard/the-new-steemfest-badge-is-ready\"><img src=\"https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmRUkELn2Fd13pWFkmWU2wBMMx39EBX5V3cHBEZ2d7f3Ve/image.png\"></a></td><td><a href=\"https://steemit.com/steemfest/@steemitboard/the-new-steemfest-badge-is-ready\">The new SteemFest⁴  badge is ready</a></td></tr></table>\n\n###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
dtubesent 0.001 STEEM to @earthempaths- "Time is running out, claim your DTube account now before anyone else can! Login at https://d.tube"
2019/08/22 16:00:42
fromdtube
toearthempaths
amount0.001 STEEM
memoTime is running out, claim your DTube account now before anyone else can! Login at https://d.tube
Transaction InfoBlock #35779223/Trx dfd924b41aa663ac40cc9d7e84a41c2f2335407a
View Raw JSON Data
{
  "trx_id": "dfd924b41aa663ac40cc9d7e84a41c2f2335407a",
  "block": 35779223,
  "trx_in_block": 45,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-08-22T16:00:42",
  "op": [
    "transfer",
    {
      "from": "dtube",
      "to": "earthempaths",
      "amount": "0.001 STEEM",
      "memo": "Time is running out, claim your DTube account now before anyone else can! Login at https://d.tube"
    }
  ]
}
steemdelegated 5.365 SP to @earthempaths
2018/12/27 00:38:57
delegatorsteem
delegateeearthempaths
vesting shares8735.590382 VESTS
Transaction InfoBlock #28916045/Trx eab27eaf72947278f66b98ee58f28730dfccc25d
View Raw JSON Data
{
  "trx_id": "eab27eaf72947278f66b98ee58f28730dfccc25d",
  "block": 28916045,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-12-27T00:38:57",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8735.590382 VESTS"
    }
  ]
}
2018/10/11 12:38:24
voterthesearethedamne
authorearthempaths
permlinksocial-crediting-cryptocurrencies-and-the-smart-grid
weight10000 (100.00%)
Transaction InfoBlock #26714243/Trx 005056de20ae03eee7c3499bad0e43424c5ab68d
View Raw JSON Data
{
  "trx_id": "005056de20ae03eee7c3499bad0e43424c5ab68d",
  "block": 26714243,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-11T12:38:24",
  "op": [
    "vote",
    {
      "voter": "thesearethedamne",
      "author": "earthempaths",
      "permlink": "social-crediting-cryptocurrencies-and-the-smart-grid",
      "weight": 10000
    }
  ]
}
steemdelegated 17.792 SP to @earthempaths
2018/10/08 16:21:06
delegatorsteem
delegateeearthempaths
vesting shares28972.702759 VESTS
Transaction InfoBlock #26632346/Trx 2288ffb40335ecb8e453282f149bd718723cec49
View Raw JSON Data
{
  "trx_id": "2288ffb40335ecb8e453282f149bd718723cec49",
  "block": 26632346,
  "trx_in_block": 35,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-08T16:21:06",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "28972.702759 VESTS"
    }
  ]
}
2018/10/07 19:17:30
parent authorearthempaths
parent permlinknarcissism-or-the-introvert-the-covert-and-the-overt
authorsteemitboard
permlinksteemitboard-notify-earthempaths-20181007t191732000z
title
bodyCongratulations @earthempaths! You have received a personal award! [![](https://steemitimages.com/70x70/http://steemitboard.com/@earthempaths/birthday1.png)](http://steemitboard.com/@earthempaths) 1 Year on Steemit <sub>_Click on the badge to view your Board of Honor._</sub> **Do not miss the last post from @steemitboard:** <table><tr><td><a href="https://steemit.com/spanish/@steemitboard/presentamos-el-ranking-de-steemitboard"><img src="https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmfRVpHQhLDhnjDtqck8GPv9NPvNKPfMsDaAFDE1D9Er2Z/header_ranking.png"></a></td><td><a href="https://steemit.com/spanish/@steemitboard/presentamos-el-ranking-de-steemitboard">Presentamos el Ranking de SteemitBoard</a></td></tr><tr><td><a href="https://steemit.com/steemitboard/@steemitboard/introducing-steemitboard-ranking"><img src="https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmfRVpHQhLDhnjDtqck8GPv9NPvNKPfMsDaAFDE1D9Er2Z/header_ranking.png"></a></td><td><a href="https://steemit.com/steemitboard/@steemitboard/introducing-steemitboard-ranking">Introducing SteemitBoard Ranking</a></td></tr></table> > Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #26607083/Trx 7c70a350497fb15a8668c385e0243f985fa4454e
View Raw JSON Data
{
  "trx_id": "7c70a350497fb15a8668c385e0243f985fa4454e",
  "block": 26607083,
  "trx_in_block": 21,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-10-07T19:17:30",
  "op": [
    "comment",
    {
      "parent_author": "earthempaths",
      "parent_permlink": "narcissism-or-the-introvert-the-covert-and-the-overt",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-earthempaths-20181007t191732000z",
      "title": "",
      "body": "Congratulations @earthempaths! You have received a personal award!\n\n[![](https://steemitimages.com/70x70/http://steemitboard.com/@earthempaths/birthday1.png)](http://steemitboard.com/@earthempaths)  1 Year on Steemit\n<sub>_Click on the badge to view your Board of Honor._</sub>\n\n\n**Do not miss the last post from @steemitboard:**\n<table><tr><td><a href=\"https://steemit.com/spanish/@steemitboard/presentamos-el-ranking-de-steemitboard\"><img src=\"https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmfRVpHQhLDhnjDtqck8GPv9NPvNKPfMsDaAFDE1D9Er2Z/header_ranking.png\"></a></td><td><a href=\"https://steemit.com/spanish/@steemitboard/presentamos-el-ranking-de-steemitboard\">Presentamos el Ranking de SteemitBoard</a></td></tr><tr><td><a href=\"https://steemit.com/steemitboard/@steemitboard/introducing-steemitboard-ranking\"><img src=\"https://steemitimages.com/64x128/https://cdn.steemitimages.com/DQmfRVpHQhLDhnjDtqck8GPv9NPvNKPfMsDaAFDE1D9Er2Z/header_ranking.png\"></a></td><td><a href=\"https://steemit.com/steemitboard/@steemitboard/introducing-steemitboard-ranking\">Introducing SteemitBoard Ranking</a></td></tr></table>\n\n> Support [SteemitBoard's project](https://steemit.com/@steemitboard)! **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2018/09/26 23:49:36
voterearthempaths
authormaxigan
permlinkmax-igan-on-the-ininite-fringe-with-bill-ray-valentine
weight10000 (100.00%)
Transaction InfoBlock #26295973/Trx 06e094f01ae81762f2785081e8401cbf77c834c5
View Raw JSON Data
{
  "trx_id": "06e094f01ae81762f2785081e8401cbf77c834c5",
  "block": 26295973,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-26T23:49:36",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "maxigan",
      "permlink": "max-igan-on-the-ininite-fringe-with-bill-ray-valentine",
      "weight": 10000
    }
  ]
}
2018/09/26 23:49:33
voterearthempaths
authormaxigan
permlinkisrael-to-blame-for-halt-in-gaza-cease-fire-negotiations
weight10000 (100.00%)
Transaction InfoBlock #26295972/Trx 7c09d5e3c5af8756c416efb234182345e26633d6
View Raw JSON Data
{
  "trx_id": "7c09d5e3c5af8756c416efb234182345e26633d6",
  "block": 26295972,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-09-26T23:49:33",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "maxigan",
      "permlink": "israel-to-blame-for-halt-in-gaza-cease-fire-negotiations",
      "weight": 10000
    }
  ]
}
steemdelegated 5.404 SP to @earthempaths
2018/08/30 21:28:30
delegatorsteem
delegateeearthempaths
vesting shares8800.095456 VESTS
Transaction InfoBlock #25531678/Trx 11b0d6b32a8f3a494caac3f495fa715fdba12803
View Raw JSON Data
{
  "trx_id": "11b0d6b32a8f3a494caac3f495fa715fdba12803",
  "block": 25531678,
  "trx_in_block": 9,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-08-30T21:28:30",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "8800.095456 VESTS"
    }
  ]
}
2018/06/12 00:03:09
parent authorearthempaths
parent permlinknarcissism-or-the-introvert-the-covert-and-the-overt
authorsteemitboard
permlinksteemitboard-notify-earthempaths-20180612t000311000z
title
bodyCongratulations @earthempaths! You have received a personal award! [![](https://steemitimages.com/70x70/http://steemitboard.com/@earthempaths/sc_verified.png)](http://steemitboard.com/@earthempaths) Steemcleaners Verified Profile <sub>_Click on the badge to view your Board of Honor._</sub> **Do not miss the [last announcement](https://steemit.com/steemitboard/@steemitboard/steemcleaners-and-steemitboard-to-offer-a-badge-to-users-who-verified-their-profile) from @steemitboard!** > Do you like [SteemitBoard's project](https://steemit.com/@steemitboard)? Then **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #23242045/Trx 5aad5f05031f62082af4f732ae551ebd6f93f03f
View Raw JSON Data
{
  "trx_id": "5aad5f05031f62082af4f732ae551ebd6f93f03f",
  "block": 23242045,
  "trx_in_block": 44,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-06-12T00:03:09",
  "op": [
    "comment",
    {
      "parent_author": "earthempaths",
      "parent_permlink": "narcissism-or-the-introvert-the-covert-and-the-overt",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-earthempaths-20180612t000311000z",
      "title": "",
      "body": "Congratulations @earthempaths! You have received a personal award!\n\n[![](https://steemitimages.com/70x70/http://steemitboard.com/@earthempaths/sc_verified.png)](http://steemitboard.com/@earthempaths)  Steemcleaners Verified Profile\n<sub>_Click on the badge to view your Board of Honor._</sub>\n\n\n**Do not miss the [last announcement](https://steemit.com/steemitboard/@steemitboard/steemcleaners-and-steemitboard-to-offer-a-badge-to-users-who-verified-their-profile) from @steemitboard!**\n\n> Do you like [SteemitBoard's project](https://steemit.com/@steemitboard)? Then **[Vote for its witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1)** and **get one more award**!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2018/05/31 18:05:24
parent author
parent permlinknarcissism
authorearthempaths
permlinknarcissism-or-the-introvert-the-covert-and-the-overt
titleNarcissism | The introvert, the covert and the overt
bodyhttp://earthempaths.net/wp/2018/05/31/narcissism-the-introvert-the-covert-and-the-overt/ ![Narciso di Jules-Cyrille Cavé.jpeg](https://cdn.steemitimages.com/DQmcJ2tKcaqxxY28w55c1cnW4kHXxAt2kr4pdbn4QJAqmNf/Narciso%20di%20Jules-Cyrille%20Cave%CC%81.jpeg) Painting: Narciso (1890) di Jules-Cyrille Cavé Way before the sun rises still deep in the quiet night she wakes. The mind opens its self to reflect on the past day, as it does much tumbles out in streams of consciousness. She listens to herself. She’s been on this river for a long time, what she hears is the lapping of water coming ashore. Standing hip deep in the stream she takes a deep breath and submerges for another plunge. Narcissism seems to be the subject du jour of the awakened collective mind, those that ponder the cause and effect of living in this world teeming with fractured humans. I am not alone in observing for many have developed an inner eye that sees within the field and acknowledges the call for further penetration. We wrestle with worn out descriptive phrases and accepted labels called ideologies, to get beyond this is an act of reflection, self reflection. Ah… so here she goes. Much has been written about narcissism and narcissistic personalities; the great calamity of living with one, the need to detach from their often well wrought covert or overt manipulations. She wants to go a little further here into the introversion of the word narcissism. These are my lessons from experience and it is what flows from my observations that I wish to share. At what moment in time did we human beings taste the first drop of blood that infused us with an ego? For ego to develop it must depend on it’s own reflection. ie: it projects into the world what it wants or needs to be affirmed and is dependent on what is reflected back to it to sustain itself. This wasn’t meant to be a negative aspect for humans when they first tasted the fruit of the tree of knowledge had not only the ability to think, but to know they think. Abstract thought and self reflection gave them the ability to become self aware. In that manner we are all narcissistic, what psychologists call healthy narcissism. My latest inner reflections, those that have been honed with the sharp sword of self observation are where my inner narcissist lays. With unremitting self observation I have learned to run through my own emotional and mental framework in a determined manner, to become transparently honest with myself. Where are my triggers, my hairpin about turns, what do I cling to, do I need to make someone wrong so I can be right? To be successful this requires ruthless self honesty. And when the sticky spider webs are found, no matter how subtle, I must acknowledge them, embrace them and allow their teachings to show me what I need to release. From observation letting go seems to be the most difficult of human challenges. Narcissism is deeper than we have discovered, by careful examination without the censoring judgemental voice that often crowds out the quiet inner one we can use such encounters as meters in which to assess our own behaviors and use the experience as a pulling salve to draw out our shadow from deep within the subconscious realms. When an ego doesn’t get the affirmation that it desires it has two distinct choices, change according to the intelligence of the field or reinstall itself in stubborn self righteousness. What happens when the inhabitant of the ego doesn’t learn to source from self it will use all means necessary to get what it wants and so the road begins for those who will develop all the nasty traits of a full blown narcissistic disorder. Recently I was challenged to run the gauntlet as someone almost forgotten surfaced through a crack in the floor boards. Immersed as I’ve been dealing with the demands of the 3D realm, my energy long ago withdrawn it caught me by surprise, a momentary surprise that arrived bearing the gift of a call to go to Great Spirit for counsel. She surfaces and exhales, much to her levity she found that for all the hooks, barbs, spidery tentacles, for the sugar coated niceties, the admonishing condemnations, and even a few covert threats she smiles seeing through it all. The development of true compassion allowed a embracing happiness for someone who continues on their chosen path, that while she sees straight through the ploys and manipulations she rejoices in another. Sharing two articles for those concerned with the plague of narcissism on our planet or are themselves impaired by someone close to them. It seems that the time is here to fully acknowledge that so many have become hallow shells living only to fulfill an imposed virtual reality dream. Few will walk the path all the way home in this life time though ultimately all will or perish. These are not dictates, they come from an accumulative gnosis of the inner realm for this is the only door through to the other side. [Do You Have A Covert Narcissist In Your Life?](https://medium.com/the-mission/do-you-have-a-covert-narcissist-in-your-life-843348ea694b) [Dispelling Wetiko](https://veilofreality.com/dispelling-wetiko/) It is likely that few don’t carry some marker of this affliction to humankind and it feels ever more vital today to take a renewed look at what we are collectively dealing with. “The self inflicted sword of truth severs completely all attachments to outcome and a being takes one further step toward freedom.” ~ Aureo Sky
json metadata{"tags":["narcissism","selfreflection"],"image":["https://cdn.steemitimages.com/DQmcJ2tKcaqxxY28w55c1cnW4kHXxAt2kr4pdbn4QJAqmNf/Narciso%20di%20Jules-Cyrille%20Cave%CC%81.jpeg"],"links":["http://earthempaths.net/wp/2018/05/31/narcissism-the-introvert-the-covert-and-the-overt/","https://medium.com/the-mission/do-you-have-a-covert-narcissist-in-your-life-843348ea694b","https://veilofreality.com/dispelling-wetiko/"],"app":"steemit/0.1","format":"markdown"}
Transaction InfoBlock #22918768/Trx 5cb707fa92db10309d3b2404629fbd860aa7eabe
View Raw JSON Data
{
  "trx_id": "5cb707fa92db10309d3b2404629fbd860aa7eabe",
  "block": 22918768,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-31T18:05:24",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "narcissism",
      "author": "earthempaths",
      "permlink": "narcissism-or-the-introvert-the-covert-and-the-overt",
      "title": "Narcissism | The introvert, the covert and the overt",
      "body": "http://earthempaths.net/wp/2018/05/31/narcissism-the-introvert-the-covert-and-the-overt/\n![Narciso di Jules-Cyrille Cavé.jpeg](https://cdn.steemitimages.com/DQmcJ2tKcaqxxY28w55c1cnW4kHXxAt2kr4pdbn4QJAqmNf/Narciso%20di%20Jules-Cyrille%20Cave%CC%81.jpeg)\n\nPainting: Narciso (1890) di Jules-Cyrille Cavé\n\nWay before the sun rises still deep in the quiet night she wakes. The mind opens its self to reflect on the past day, as it does much tumbles out in streams of consciousness. She listens to herself.  She’s been on this river for a long time, what she hears is the lapping of water coming ashore. Standing hip deep in the stream she takes a deep breath and submerges for another plunge.\n\nNarcissism seems to be the subject du jour of the awakened collective mind, those that ponder the cause and effect of living in this world teeming with fractured humans. I am not alone in observing for many have developed an inner eye that sees within the field and acknowledges the call for further penetration. We wrestle with worn out descriptive phrases and accepted labels called ideologies, to get beyond this is an act of reflection, self reflection.\n\nAh… so here she goes.\n\nMuch has been written about narcissism and narcissistic personalities; the great calamity of living with one, the need to detach from their often well wrought covert or overt manipulations. She wants to go a little further here into the introversion of the word narcissism.\n\nThese are my lessons from experience and it is what flows from my observations that I wish to share. At what moment in time did we human beings taste the first drop of blood that infused us with an ego? For ego to develop it must depend on it’s own reflection. ie: it projects into the world what it wants or needs to be affirmed and is dependent on what is reflected back to it to sustain itself. This wasn’t meant to be a negative aspect for humans when they first tasted the fruit of the tree of knowledge had not only the ability to think, but to know they think. Abstract thought and self reflection gave them the ability to become self aware. In that manner we are all narcissistic, what psychologists call healthy narcissism.\n\nMy latest inner reflections, those that have been honed with the sharp sword of self observation are where my inner narcissist lays. With unremitting self observation I have learned to run through my own emotional and mental framework in a determined manner, to become transparently honest with myself. Where are my triggers, my hairpin about turns, what do I cling to, do I need to make someone wrong so I can be right?  To be successful this requires ruthless self honesty. And when the sticky spider webs are found, no matter how subtle, I must acknowledge them, embrace them and allow their teachings to show me what I need to release. From observation letting go seems to be the most difficult of human challenges. Narcissism is deeper than we have discovered, by careful examination without the censoring judgemental voice that often crowds out the quiet inner one we can use such encounters as meters in which to assess our own behaviors and use the experience as a pulling salve to draw out our shadow from deep within the subconscious realms.\n\nWhen an ego doesn’t get the affirmation that it desires it has two distinct choices, change according to the intelligence of the field or reinstall itself in stubborn self righteousness. What happens when the inhabitant of the ego doesn’t learn to source from self it will use all means necessary to get what it wants and so the road begins for those who will develop all the nasty traits of a full blown narcissistic disorder.\n\nRecently I was challenged to run the gauntlet as someone almost forgotten surfaced through a crack in the floor boards. Immersed as I’ve been dealing with the demands of the 3D realm, my energy long ago withdrawn it caught me by surprise, a momentary surprise that arrived bearing the gift of a call to go to Great Spirit for counsel.\n\nShe surfaces and exhales, much to her levity she found that for all the hooks, barbs, spidery tentacles, for the sugar coated niceties, the admonishing condemnations, and even a few covert threats she smiles seeing through it all. \n\nThe development of true compassion allowed a embracing happiness for someone who continues on their chosen path, that while she sees straight through the ploys and manipulations she rejoices in another.\n\nSharing two articles for those concerned with the plague of narcissism on our planet or are themselves impaired by someone close to them. It seems that the time is here to fully acknowledge that so many have become hallow shells living only to fulfill an imposed virtual reality dream. Few will walk the path all the way home in this life time though ultimately all will or perish. These are not dictates, they come from an accumulative gnosis of the inner realm for this is the only door through to the other side.\n\n[Do You Have A Covert Narcissist In Your Life?](https://medium.com/the-mission/do-you-have-a-covert-narcissist-in-your-life-843348ea694b)\n[Dispelling Wetiko](https://veilofreality.com/dispelling-wetiko/)\n\nIt is likely that few don’t carry some marker of this affliction to humankind and it feels ever more vital today to take a renewed look at what we are collectively dealing with.\n\n“The self inflicted sword of truth severs completely all attachments to outcome and a being takes one further step toward freedom.” ~ Aureo Sky",
      "json_metadata": "{\"tags\":[\"narcissism\",\"selfreflection\"],\"image\":[\"https://cdn.steemitimages.com/DQmcJ2tKcaqxxY28w55c1cnW4kHXxAt2kr4pdbn4QJAqmNf/Narciso%20di%20Jules-Cyrille%20Cave%CC%81.jpeg\"],\"links\":[\"http://earthempaths.net/wp/2018/05/31/narcissism-the-introvert-the-covert-and-the-overt/\",\"https://medium.com/the-mission/do-you-have-a-covert-narcissist-in-your-life-843348ea694b\",\"https://veilofreality.com/dispelling-wetiko/\"],\"app\":\"steemit/0.1\",\"format\":\"markdown\"}"
    }
  ]
}
2018/05/28 12:39:24
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
sbd payout0.136 SBD
steem payout0.000 STEEM
vesting payout105.748159 VESTS
Transaction InfoBlock #22825858/Virtual Operation #7
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 22825858,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 7,
  "timestamp": "2018-05-28T12:39:24",
  "op": [
    "author_reward",
    {
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "sbd_payout": "0.136 SBD",
      "steem_payout": "0.000 STEEM",
      "vesting_payout": "105.748159 VESTS"
    }
  ]
}
howoreceived 0.006 SP benefactor reward from @earthempaths
2018/05/28 12:39:24
benefactorhowo
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
sbd payout0.000 SBD
steem payout0.000 STEEM
vesting payout10.168092 VESTS
Transaction InfoBlock #22825858/Virtual Operation #6
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 22825858,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 6,
  "timestamp": "2018-05-28T12:39:24",
  "op": [
    "comment_benefactor_reward",
    {
      "benefactor": "howo",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "sbd_payout": "0.000 SBD",
      "steem_payout": "0.000 STEEM",
      "vesting_payout": "10.168092 VESTS"
    }
  ]
}
fredrikaareceived 0.006 SP benefactor reward from @earthempaths
2018/05/28 12:39:24
benefactorfredrikaa
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
sbd payout0.000 SBD
steem payout0.000 STEEM
vesting payout10.168092 VESTS
Transaction InfoBlock #22825858/Virtual Operation #5
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 22825858,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 5,
  "timestamp": "2018-05-28T12:39:24",
  "op": [
    "comment_benefactor_reward",
    {
      "benefactor": "fredrikaa",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "sbd_payout": "0.000 SBD",
      "steem_payout": "0.000 STEEM",
      "vesting_payout": "10.168092 VESTS"
    }
  ]
}
2018/05/26 20:03:24
required auths[]
required posting auths["earthempaths"]
idfollow
json["follow",{"follower":"earthempaths","following":"mentonyt","what":["blog"]}]
Transaction InfoBlock #22777146/Trx d534667d67b92dd70c157f4912327695cbb5b120
View Raw JSON Data
{
  "trx_id": "d534667d67b92dd70c157f4912327695cbb5b120",
  "block": 22777146,
  "trx_in_block": 22,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T20:03:24",
  "op": [
    "custom_json",
    {
      "required_auths": [],
      "required_posting_auths": [
        "earthempaths"
      ],
      "id": "follow",
      "json": "[\"follow\",{\"follower\":\"earthempaths\",\"following\":\"mentonyt\",\"what\":[\"blog\"]}]"
    }
  ]
}
2018/05/26 18:21:24
votermentonyt
authorearthempaths
permlinksoliloquyforhumanity-5nrh748m9y
weight10000 (100.00%)
Transaction InfoBlock #22775107/Trx 7510b857a6edfa433933fffd6aac6ae803550338
View Raw JSON Data
{
  "trx_id": "7510b857a6edfa433933fffd6aac6ae803550338",
  "block": 22775107,
  "trx_in_block": 21,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T18:21:24",
  "op": [
    "vote",
    {
      "voter": "mentonyt",
      "author": "earthempaths",
      "permlink": "soliloquyforhumanity-5nrh748m9y",
      "weight": 10000
    }
  ]
}
2018/05/26 18:18:06
parent author
parent permlinksteempress
authorearthempaths
permlinksoliloquyforhumanity-5nrh748m9y
titleSoliloquy for Humanity
body@@ -1,16 +1,161 @@ +!%5Bwoman-under-water-painting.png%5D(https://cdn.steemitimages.com/DQmaKSSARL554zyZDHLK6hqpU41z7NzCHqJf1pFTo9YmWs3/woman-under-water-painting.png)%0A%0A %3Cp%3E%3Cem%3EShe woke @@ -702,25 +702,24 @@ e.%C2%A0%3C/em%3E%3C/p%3E -%0D %0A%3Cp%3ENo dispa @@ -1258,25 +1258,24 @@ lvation.%3C/p%3E -%0D %0A%3Cp%3EThese ra @@ -1648,25 +1648,24 @@ unaware.%3C/p%3E -%0D %0A%3Cp%3E%3Cem%3EShe @@ -1762,25 +1762,24 @@ e. %3C/em%3E%3C/p%3E -%0D %0A%3Cp%3EWhen thi @@ -2543,15 +2543,13 @@ uls. -%0D %0A%3C/p%3E -%0D %0A%3Cp%3E @@ -3016,25 +3016,24 @@ display.%3C/p%3E -%0D %0A%3Cp%3EThe Matr @@ -3745,25 +3745,24 @@ course.%3C/p%3E -%0D %0A%3Cp%3EIn the c @@ -4385,25 +4385,24 @@ ly true.%3C/p%3E -%0D %0A%3Cp%3EMost tim @@ -4916,25 +4916,24 @@ pplause.%3C/p%3E -%0D %0A%3Cp%3EYes, the @@ -5147,25 +5147,24 @@ changes.%3C/p%3E -%0D %0A%3Cp%3E%3Cem%3EShe @@ -5399,25 +5399,24 @@ ir.%3C/em%3E%3C/p%3E -%0D %0A%3Cp%3E________ @@ -5434,25 +5434,24 @@ ________%3C/p%3E -%0D %0A%3Cp%3E%3Cem%3E %22I @@ -6066,17 +6066,16 @@ less%3C/a%3E -%0D %0A%3C/em%3E%3C/ @@ -6080,18 +6080,16 @@ %3C/p%3E -%0D %0A%3Cp%3E%3C/p%3E -%0D %0A%3Cp%3E
json metadata{"community":"steempress","app":"steemit/0.1","image":["https://cdn.steemitimages.com/DQmaKSSARL554zyZDHLK6hqpU41z7NzCHqJf1pFTo9YmWs3/woman-under-water-painting.png"],"tags":["steempress","steem"],"links":["https://en.wikipedia.org/wiki/Eschatology","https://steemit.com/@aprilpeerless","https://mymodernmet.com/erika-craig-water-series-oil-paintings/","https://wordpress.org/plugins/steempress/","http://earthempaths.net/wp/2018/05/26/soliloquy-for-humanity/"],"format":"markdown"}
Transaction InfoBlock #22775041/Trx b9cfa7fff0fe05ccbca2a77a646a499ffdad4301
View Raw JSON Data
{
  "trx_id": "b9cfa7fff0fe05ccbca2a77a646a499ffdad4301",
  "block": 22775041,
  "trx_in_block": 58,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T18:18:06",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "earthempaths",
      "permlink": "soliloquyforhumanity-5nrh748m9y",
      "title": "Soliloquy for Humanity",
      "body": "@@ -1,16 +1,161 @@\n+!%5Bwoman-under-water-painting.png%5D(https://cdn.steemitimages.com/DQmaKSSARL554zyZDHLK6hqpU41z7NzCHqJf1pFTo9YmWs3/woman-under-water-painting.png)%0A%0A\n %3Cp%3E%3Cem%3EShe woke \n@@ -702,25 +702,24 @@\n e.%C2%A0%3C/em%3E%3C/p%3E\n-%0D\n %0A%3Cp%3ENo dispa\n@@ -1258,25 +1258,24 @@\n lvation.%3C/p%3E\n-%0D\n %0A%3Cp%3EThese ra\n@@ -1648,25 +1648,24 @@\n unaware.%3C/p%3E\n-%0D\n %0A%3Cp%3E%3Cem%3EShe \n@@ -1762,25 +1762,24 @@\n e. %3C/em%3E%3C/p%3E\n-%0D\n %0A%3Cp%3EWhen thi\n@@ -2543,15 +2543,13 @@\n uls.\n-%0D\n %0A%3C/p%3E\n-%0D\n %0A%3Cp%3E\n@@ -3016,25 +3016,24 @@\n display.%3C/p%3E\n-%0D\n %0A%3Cp%3EThe Matr\n@@ -3745,25 +3745,24 @@\n  course.%3C/p%3E\n-%0D\n %0A%3Cp%3EIn the c\n@@ -4385,25 +4385,24 @@\n ly true.%3C/p%3E\n-%0D\n %0A%3Cp%3EMost tim\n@@ -4916,25 +4916,24 @@\n pplause.%3C/p%3E\n-%0D\n %0A%3Cp%3EYes, the\n@@ -5147,25 +5147,24 @@\n changes.%3C/p%3E\n-%0D\n %0A%3Cp%3E%3Cem%3EShe \n@@ -5399,25 +5399,24 @@\n ir.%3C/em%3E%3C/p%3E\n-%0D\n %0A%3Cp%3E________\n@@ -5434,25 +5434,24 @@\n ________%3C/p%3E\n-%0D\n %0A%3Cp%3E%3Cem%3E %22I \n@@ -6066,17 +6066,16 @@\n less%3C/a%3E\n-%0D\n %0A%3C/em%3E%3C/\n@@ -6080,18 +6080,16 @@\n %3C/p%3E\n-%0D\n %0A%3Cp%3E%3C/p%3E\n-%0D\n %0A%3Cp%3E\n",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steemit/0.1\",\"image\":[\"https://cdn.steemitimages.com/DQmaKSSARL554zyZDHLK6hqpU41z7NzCHqJf1pFTo9YmWs3/woman-under-water-painting.png\"],\"tags\":[\"steempress\",\"steem\"],\"links\":[\"https://en.wikipedia.org/wiki/Eschatology\",\"https://steemit.com/@aprilpeerless\",\"https://mymodernmet.com/erika-craig-water-series-oil-paintings/\",\"https://wordpress.org/plugins/steempress/\",\"http://earthempaths.net/wp/2018/05/26/soliloquy-for-humanity/\"],\"format\":\"markdown\"}"
    }
  ]
}
2018/05/26 18:11:09
voterearthempaths
authorearthempaths
permlinksoliloquyforhumanity-5nrh748m9y
weight10000 (100.00%)
Transaction InfoBlock #22774902/Trx 2cf6e31454d3cdb654440fe55aaf3e7422d8c2a2
View Raw JSON Data
{
  "trx_id": "2cf6e31454d3cdb654440fe55aaf3e7422d8c2a2",
  "block": 22774902,
  "trx_in_block": 35,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T18:11:09",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "soliloquyforhumanity-5nrh748m9y",
      "weight": 10000
    }
  ]
}
2018/05/26 18:11:09
authorearthempaths
permlinksoliloquyforhumanity-5nrh748m9y
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #22774902/Trx 2cf6e31454d3cdb654440fe55aaf3e7422d8c2a2
View Raw JSON Data
{
  "trx_id": "2cf6e31454d3cdb654440fe55aaf3e7422d8c2a2",
  "block": 22774902,
  "trx_in_block": 35,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T18:11:09",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "soliloquyforhumanity-5nrh748m9y",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2018/05/26 18:11:09
parent author
parent permlinksteempress
authorearthempaths
permlinksoliloquyforhumanity-5nrh748m9y
titleSoliloquy for Humanity
body<p><em>She woke this morning with her thoughts punctuated by continuous fire crackers blasting the morning skies calling to the unknown gods, a people's petition to be saved.  Then her barely formed thoughts are carried away on the dissonance of the out-of-tune marching band that goes up and down the street outside her door. She laughs to herself for what better manifestation of human unconsciousness than this display of humanity's child-like nature, it's a pageantry that speaks volumes though few have a clue as to why they march to the dissonant tune. </em></p> <p>No disparaging judgemental thoughts entered with this morning's disturbance to my normally silent reverie, it is hard to judge a mass of human fiesta-making no matter how deep I see into what drives it, no matter how many layers I have peeled away. To these revelers what I see is of no importance for they follow the foot path laid before them, blind to the hidden hand on the wheel of social engineering. Next week they will come down our street on their knees bearing gifts of repentance to the priestly knaves that ply false words of salvation.</p> <p>These ramblings of my mind need to be said, written down in some form for there is the inner spiritual rebel that cries to be heard. It is not directed at the people who seem to wander aimlessly, led in loops by black cloaked priests who grin down on their flock. Oh, these ones know, they know for they've sold their slivers of souls to garner the hard earned pesos of the unaware.</p> <p><em>She observes and listens deeper now, a further plunge into what moves her on the waters of life. </em></p> <p>When this writing started to form it had a different tone, one of sad admonishment for our common plight. We've let ourselves go too far down the road of a technological and <a href="https://en.wikipedia.org/wiki/Eschatology" target="_blank">eschatological</a>ly induced trance. Knowing this is what fans the inner fire, that which wants to share so to rip away one more layer of a bipolar world view. We've been split, duplicated and replicated to such a degree that few have been able to maintain the inner domain. We are balanced on the head of a pin while the winds of war are fanned and the deceivers reveal themselves with poorly hatched plans that are doomed to fail. An epic failure for destruction and death is what drives the power brokers with vacant souls. </p> <p>We can gather unto ourselves all knowledge, the world is an open book to be read, ruminated on and churned in the fields of our perception. What I keep finding is that the stories we tell, the mythologies of our past and present, the scientific discoveries and all the entertraining medias run the same course, they always bring one back to self and that is what I feel most of us miss most the time for we all are immersed in a timeless extravaganza of human display.</p> <p>The Matrix as it is commonly called is all pervasive, it isn't something separate from the self that we can escape from. In essence there is no other and all thought that draws us in that direction dis-empowers us by keeping the bipolar world alive. We can postulate, research, delve and dive and indeed an inquiring mind will need to do this, leaving no stone unturned for in seeking the truth of our essential nature we are that which we always were. And when, with courage and fortitude, we admit to ourselves that there is no separation, no other to blame we come closer to finally seeing that all is within us. We can't become better people, we can't undo the past trajectory but we can influence the present course.</p> <p>In the coming days we will be called to express from that place in ourselves that <em>knows</em>, not the mind alone but with the heart of compassionate wisdom, that place we long for called home. Knowing can only be garnered with experience and no one has the same experiences as another and that is what makes this such a marvelous tragicomedy weave. Even as these words flow through me I am cognizant of those who weave with a master stroke. Alone and not alone seems to be the same truth now just as all and nothing are simultaneously embraced. Yes, the mind rebels against such thought and yet it is joyfully and solemnly true.</p> <p>Most times when I am writing I am aware of those whose words have expressed my own sentiments, those who come home again and again finding the truth of their being inside. We rise, we fall. We seek, we find. We have found our inner flame and that is true Knowledge. No longer dependent on finding someone or something else to follow we've stopped chasing our tail and have learned the rudiments of sourcing from within. This is often a lonely stark place to be, it doesn't have bells and whistles nor fanfare, nor applause.</p> <p>Yes, the Matrix is ... corrupted with all the greed and numbed feelings of the followers of the next new fad. When we learn to bend the field with the pure heart of love I think we will be astonished at how fast it changes.</p> <p><em>She closes this soliloquy for another band rumbles by outside, the drums beating loudly in a demanding foot marching rhythm people follow and more followers follow those that lead the way to the church door, temple of doom and despair.</em></p> <p>___________________________</p> <p><em> "I am deep.. I am shallow.. I am opened.. I am closed.. I seek.. I love.. I fall.. I have been torn within my spirit and drawn into the dark place. It was because of no one, but from only myself.. It was there I saw the light and heard a voice that began calling me saying ”Come dance with me and you will be freed and I will share beauties through your heart.” I reached.. I touched.. I did not shudder.. I took and opened my essence unto the light.. Ah embraced by what I truly sought. I accept.. I let go.. and I fly and I seek.."   ~   <a href="https://steemit.com/@aprilpeerless" target="_blank">April Peerless</a> </em></p> <p></p> <p>Image Credit: Painting by <a href="https://mymodernmet.com/erika-craig-water-series-oil-paintings/" target="_blank">Erika Craig</a></p><br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/26/soliloquy-for-humanity/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.2","image":[""],"tags":["steempress","steem"]}
Transaction InfoBlock #22774902/Trx 2cf6e31454d3cdb654440fe55aaf3e7422d8c2a2
View Raw JSON Data
{
  "trx_id": "2cf6e31454d3cdb654440fe55aaf3e7422d8c2a2",
  "block": 22774902,
  "trx_in_block": 35,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T18:11:09",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "earthempaths",
      "permlink": "soliloquyforhumanity-5nrh748m9y",
      "title": "Soliloquy for Humanity",
      "body": "<p><em>She woke this morning with her thoughts punctuated by continuous fire crackers blasting the morning skies calling to the unknown gods, a people's petition to be saved.  Then her barely formed thoughts are carried away on the dissonance of the out-of-tune marching band that goes up and down the street outside her door. She laughs to herself for what better manifestation of human unconsciousness than this display of humanity's child-like nature, it's a pageantry that speaks volumes though few have a clue as to why they march to the dissonant tune. </em></p>\r\n<p>No disparaging judgemental thoughts entered with this morning's disturbance to my normally silent reverie, it is hard to judge a mass of human fiesta-making no matter how deep I see into what drives it, no matter how many layers I have peeled away. To these revelers what I see is of no importance for they follow the foot path laid before them, blind to the hidden hand on the wheel of social engineering. Next week they will come down our street on their knees bearing gifts of repentance to the priestly knaves that ply false words of salvation.</p>\r\n<p>These ramblings of my mind need to be said, written down in some form for there is the inner spiritual rebel that cries to be heard. It is not directed at the people who seem to wander aimlessly, led in loops by black cloaked priests who grin down on their flock. Oh, these ones know, they know for they've sold their slivers of souls to garner the hard earned pesos of the unaware.</p>\r\n<p><em>She observes and listens deeper now, a further plunge into what moves her on the waters of life. </em></p>\r\n<p>When this writing started to form it had a different tone, one of sad admonishment for our common plight. We've let ourselves go too far down the road of a technological and  <a href=\"https://en.wikipedia.org/wiki/Eschatology\" target=\"_blank\">eschatological</a>ly induced trance. Knowing this is what fans the inner fire, that which wants to share so to rip away one more layer of a bipolar world view. We've been split, duplicated and replicated to such a degree that few have been able to maintain the inner domain. We are balanced on the head of a pin while the winds of war are fanned and the deceivers reveal themselves with poorly hatched plans that are doomed to fail. An epic failure for destruction and death is what drives the power brokers with vacant souls.\r\n</p>\r\n<p>We can gather unto ourselves all knowledge, the world is an open book to be read, ruminated on and churned in the fields of our perception. What I keep finding is that the stories we tell, the mythologies of our past and present, the scientific discoveries and all the entertraining medias run the same course, they always bring one back to self and that is what I feel most of us miss most the time for we all are immersed in a timeless extravaganza of human display.</p>\r\n<p>The Matrix as it is commonly called is all pervasive, it isn't something separate from the self that we can escape from. In essence there is no other and all thought that draws us in that direction dis-empowers us by keeping the bipolar world alive. We can postulate, research, delve and dive and indeed an inquiring mind will need to do this, leaving no stone unturned for in seeking the truth of our essential nature we are that which we always were. And when, with courage and fortitude, we admit to ourselves that there is no separation, no other to blame we come closer to finally seeing that all is within us. We can't become better people, we can't undo the past trajectory but we can influence the present course.</p>\r\n<p>In the coming days we will be called to express from that place in ourselves that <em>knows</em>, not the mind alone but with the heart of compassionate wisdom, that place we long for called home. Knowing can only be garnered with experience and no one has the same experiences as another and that is what makes this such a marvelous tragicomedy weave. Even as these words flow through me I am cognizant of those who weave with a master stroke. Alone and not alone seems to be the same truth now just as all and nothing are simultaneously embraced. Yes, the mind rebels against such thought and yet it is joyfully and solemnly true.</p>\r\n<p>Most times when I am writing I am aware of those whose words have expressed my own sentiments, those who come home again and again finding the truth of their being inside. We rise, we fall. We seek, we find. We have found our inner flame and that is true Knowledge. No longer dependent on finding someone or something else to follow we've stopped chasing our tail and have learned the rudiments of sourcing from within. This is often a lonely stark place to be, it doesn't have bells and whistles nor fanfare, nor applause.</p>\r\n<p>Yes, the Matrix is ... corrupted with all the greed and numbed feelings of the followers of the next new fad. When we learn to bend the field with the pure heart of love I think we will be astonished at how fast it changes.</p>\r\n<p><em>She closes this soliloquy for another band rumbles by outside, the drums beating loudly in a demanding foot marching rhythm people follow and more followers follow those that lead the way to the church door, temple of doom and despair.</em></p>\r\n<p>___________________________</p>\r\n<p><em> \"I am deep.. I am shallow.. I am opened.. I am closed.. I seek.. I love.. I fall.. I have been torn within my spirit and drawn into the dark place. It was because of no one, but from only myself.. It was there I saw the light and heard a voice that began calling me saying ”Come dance with me and you will be freed and I will share beauties through your heart.” I reached.. I touched.. I did not shudder.. I took and opened my essence unto the light.. Ah embraced by what I truly sought. I accept.. I let go.. and I fly and I seek..\"   ~   <a href=\"https://steemit.com/@aprilpeerless\" target=\"_blank\">April Peerless</a>\r\n</em></p>\r\n<p></p>\r\n<p>Image Credit: Painting by <a href=\"https://mymodernmet.com/erika-craig-water-series-oil-paintings/\" target=\"_blank\">Erika Craig</a></p><br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/26/soliloquy-for-humanity/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.2\",\"image\":[\"\"],\"tags\":[\"steempress\",\"steem\"]}"
    }
  ]
}
earthempathsclaimed reward balance: 0.002 STEEM, 0.007 SBD, 0.009 SP
2018/05/26 13:21:57
accountearthempaths
reward steem0.002 STEEM
reward sbd0.007 SBD
reward vests14.276026 VESTS
Transaction InfoBlock #22769120/Trx 6a87393d4c15fa1ed2bbba8151f68bf2c9dbb198
View Raw JSON Data
{
  "trx_id": "6a87393d4c15fa1ed2bbba8151f68bf2c9dbb198",
  "block": 22769120,
  "trx_in_block": 38,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T13:21:57",
  "op": [
    "claim_reward_balance",
    {
      "account": "earthempaths",
      "reward_steem": "0.002 STEEM",
      "reward_sbd": "0.007 SBD",
      "reward_vests": "14.276026 VESTS"
    }
  ]
}
2018/05/26 12:42:48
required auths[]
required posting auths["earthempaths"]
idfollow
json["follow",{"follower":"earthempaths","following":"aprilpeerless","what":["blog"]}]
Transaction InfoBlock #22768337/Trx 88c9d2c684be91468317f45ce2f5e65aa96b8dac
View Raw JSON Data
{
  "trx_id": "88c9d2c684be91468317f45ce2f5e65aa96b8dac",
  "block": 22768337,
  "trx_in_block": 12,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-26T12:42:48",
  "op": [
    "custom_json",
    {
      "required_auths": [],
      "required_posting_auths": [
        "earthempaths"
      ],
      "id": "follow",
      "json": "[\"follow\",{\"follower\":\"earthempaths\",\"following\":\"aprilpeerless\",\"what\":[\"blog\"]}]"
    }
  ]
}
2018/05/22 09:11:18
votersteempress-io
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
weight782 (7.82%)
Transaction InfoBlock #22649302/Trx 18f8dc30091ebdddcd0ee4a1f8c9a05427be1771
View Raw JSON Data
{
  "trx_id": "18f8dc30091ebdddcd0ee4a1f8c9a05427be1771",
  "block": 22649302,
  "trx_in_block": 27,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-22T09:11:18",
  "op": [
    "vote",
    {
      "voter": "steempress-io",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "weight": 782
    }
  ]
}
2018/05/21 21:03:09
votersteemitboard
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
weight100 (1.00%)
Transaction InfoBlock #22634741/Trx 7084b6bd466ce8cea33bcb940b33e9f06d0e4d3d
View Raw JSON Data
{
  "trx_id": "7084b6bd466ce8cea33bcb940b33e9f06d0e4d3d",
  "block": 22634741,
  "trx_in_block": 13,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T21:03:09",
  "op": [
    "vote",
    {
      "voter": "steemitboard",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "weight": 100
    }
  ]
}
2018/05/21 21:03:06
parent authorearthempaths
parent permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
authorsteemitboard
permlinksteemitboard-notify-earthempaths-20180521t210308000z
title
bodyCongratulations @earthempaths! You have completed some achievement on Steemit and have been rewarded with new badge(s) : [![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/posts.png)](http://steemitboard.com/@earthempaths) Award for the number of posts published Click on any badge to view your own Board of Honor on SteemitBoard. To support your work, I also upvoted your post! For more information about SteemitBoard, click [here](https://steemit.com/@steemitboard) If you no longer want to receive notifications, reply to this comment with the word `STOP` > Upvote this notification to help all Steemit users. Learn why [here](https://steemit.com/steemitboard/@steemitboard/http-i-cubeupload-com-7ciqeo-png)!
json metadata{"image":["https://steemitboard.com/img/notifications.png"]}
Transaction InfoBlock #22634740/Trx bcacce51eaeffd8f1a237960c86f78c6bd668f17
View Raw JSON Data
{
  "trx_id": "bcacce51eaeffd8f1a237960c86f78c6bd668f17",
  "block": 22634740,
  "trx_in_block": 48,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T21:03:06",
  "op": [
    "comment",
    {
      "parent_author": "earthempaths",
      "parent_permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-earthempaths-20180521t210308000z",
      "title": "",
      "body": "Congratulations @earthempaths! You have completed some achievement on Steemit and have been rewarded with new badge(s) :\n\n[![](https://steemitimages.com/70x80/http://steemitboard.com/notifications/posts.png)](http://steemitboard.com/@earthempaths) Award for the number of posts published\n\nClick on any badge to view your own Board of Honor on SteemitBoard.\n\nTo support your work, I also upvoted your post!\nFor more information about SteemitBoard, click [here](https://steemit.com/@steemitboard)\n\nIf you no longer want to receive notifications, reply to this comment with the word `STOP`\n\n> Upvote this notification to help all Steemit users. Learn why [here](https://steemit.com/steemitboard/@steemitboard/http-i-cubeupload-com-7ciqeo-png)!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notifications.png\"]}"
    }
  ]
}
2018/05/21 13:11:12
voterboy
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
weight10000 (100.00%)
Transaction InfoBlock #22625302/Trx 91543ed52c7f01a7f20cf945e0572a6408df6d33
View Raw JSON Data
{
  "trx_id": "91543ed52c7f01a7f20cf945e0572a6408df6d33",
  "block": 22625302,
  "trx_in_block": 55,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T13:11:12",
  "op": [
    "vote",
    {
      "voter": "boy",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "weight": 10000
    }
  ]
}
2018/05/21 13:11:09
voterbue
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
weight10000 (100.00%)
Transaction InfoBlock #22625301/Trx d6714c42f5d3bf2e9abbf9ede632a715fce4162a
View Raw JSON Data
{
  "trx_id": "d6714c42f5d3bf2e9abbf9ede632a715fce4162a",
  "block": 22625301,
  "trx_in_block": 9,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T13:11:09",
  "op": [
    "vote",
    {
      "voter": "bue",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "weight": 10000
    }
  ]
}
2018/05/21 13:09:18
voterhr1
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
weight2 (0.02%)
Transaction InfoBlock #22625264/Trx 8f2dedc9ff412171971c9ace2840645a47da7259
View Raw JSON Data
{
  "trx_id": "8f2dedc9ff412171971c9ace2840645a47da7259",
  "block": 22625264,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T13:09:18",
  "op": [
    "vote",
    {
      "voter": "hr1",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "weight": 2
    }
  ]
}
2018/05/21 12:39:24
voterearthempaths
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
weight10000 (100.00%)
Transaction InfoBlock #22624666/Trx ec9fea2fe0e8f51cb78323daf53468e8e925caed
View Raw JSON Data
{
  "trx_id": "ec9fea2fe0e8f51cb78323daf53468e8e925caed",
  "block": 22624666,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T12:39:24",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "weight": 10000
    }
  ]
}
2018/05/21 12:39:24
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #22624666/Trx ec9fea2fe0e8f51cb78323daf53468e8e925caed
View Raw JSON Data
{
  "trx_id": "ec9fea2fe0e8f51cb78323daf53468e8e925caed",
  "block": 22624666,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T12:39:24",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2018/05/21 12:39:24
parent author
parent permlinkawareness
authorearthempaths
permlinkhawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27
titleHawaii's Kilauea Volcano | Mother's Caldron Simmers
body<p><em>She is wont to mix metaphors and draw lines that don't go straight so bear with the meandering of her flows. Much like the lava moving across the landscape of Hawaii's big island so move the metaphors of her mind.</em></p> <p>A very good friend asked what I thought of this article, <a href="https://www.zerohedge.com/news/2018-05-18/hawaii-national-guard-whistleblowers-warn-friends-family-imminent-power-plant" target="_blank">Hawaii National Guard Whistleblowers Warn Friends, Family Of Imminent Power-Plant Explosion, Tsunami </a>on ZeroHedge and it prompted a reply.</p> <p><em>"I actually have some deep feelings, pun intended. It seems my critical mind wants to merge with my feeling body so allowing that I ‘feel’ that the article is basically fake news meant to provoke fear. It follows a pattern I’ve seen many times, whistle blower headline and lacking any in-depth analysis of the geological area. A volcano of that magnitude is more likely to cause a tsunami than a lot of explosives. I actually don’t think the bastards want to do that … However, never let a good disaster go to waste. It seems to me that population control, ie: mind control is more the agenda than wiping out the Hawaiian Islands or the coast of California. The insanity of building power stations next to volcanoes and nuclear facilities on fault lines is pure hubris and stupidity in spades. </em></p> <p><em>That said it is likely that fracking is a contributing factor to mother getting pissed off or rather letting off some steam. Unless there is a nuclear device deep under ground a surface explosion would not come anywhere close to provoking a tsunami. What I find interesting when scanning ZeroHedge, which I grok daily to keep a finger on the pulse of the insanity, are the reader comments. The thermal power plant is some five to seven miles inland so as one reader commented: “There is no way a power plant explosion is going to cause a tsunami.  You need vertical movement to the sea bed to accomplish that.” which I my critical mind can make no argument with. </em></p> <p><img src="http://earthempaths.net/wp/wp-content/uploads/2018/05/Lava-hitting-the-sea.jpg" alt="Lava hitting the sea" width="900" height="600" /><br><em>Lava reaching the Pacific Ocean</em></p> <p><em>That something unnatural is occurring, of that I have no doubt for most of humanity is bonded to the unnatural and wouldn’t know real even as it hits them in the face. Even the word natural seems to be losing all context. LOL, maybe it’s time for me to write an article as I seem to be in my sardonic flow." </em></p> <p>~~~</p> <p>I write in tone and metaphor that what is happening in Hawaii is a natural event and while the puny humans with big tech toys play around with her mantle she is so much more powerful in her core. Opening the inner eye to a reality that is showing us through the magnificence of her power is stepping into the realm of the 94% of the real that few will ever know. When a volcano erupts or a hurricane churns one would think that we humans would feel the awe of our ancestors for we are living on a planet of extraordinary conception and manifestation. Sadly most are locked into the trivial virtual reality and all is reduced to the next news release. Almost no one seems to be capable of seeing the whole or maintaining any semblance of viewing from a frame of reference that includes geological time. We are being reduced to automatons with predictable responses.</p> <p>When I see images, I <em>see</em>. A lava flow is a dragon, a plasma creature that is life and as all is consciousness this speaks to me. Perhaps not in the words of prose or linear language but in the emanation of core spirit. I sing a hallelujah inside when Mother demonstrates herself in such splendor. Is she to care for the estates built on her spiny back by ignorant moneyed people, is she to care for the ineptitude of her reckless children when we have cared so little for her?</p> <p></p> <p><img src="http://earthempaths.net/wp/wp-content/uploads/2018/05/Lava-dragon.jpg" alt="Lava dragon" width="1010" height="682" /><br><em>Lava Dragon</em></p><br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/21/hawaiis-kilauea-volcano-mothers-caldron-simmers/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.2","image":[""],"tags":["awareness","kilauea","metaphor"]}
Transaction InfoBlock #22624666/Trx ec9fea2fe0e8f51cb78323daf53468e8e925caed
View Raw JSON Data
{
  "trx_id": "ec9fea2fe0e8f51cb78323daf53468e8e925caed",
  "block": 22624666,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T12:39:24",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "awareness",
      "author": "earthempaths",
      "permlink": "hawaiiskilaueavolcanomotherscaldronsimmers-dvax9s7o27",
      "title": "Hawaii's Kilauea Volcano | Mother's Caldron Simmers",
      "body": "<p><em>She is wont to mix metaphors and draw lines that don't go straight so bear with the meandering of her flows. Much like the lava moving across the landscape of Hawaii's big island so move the metaphors of her mind.</em></p>\r\n<p>A very good friend asked what I thought of this article, <a href=\"https://www.zerohedge.com/news/2018-05-18/hawaii-national-guard-whistleblowers-warn-friends-family-imminent-power-plant\" target=\"_blank\">Hawaii National Guard Whistleblowers Warn Friends, Family Of Imminent Power-Plant Explosion, Tsunami </a>on ZeroHedge and it prompted a reply.</p>\r\n<p><em>\"I actually have some deep feelings, pun intended. It seems my critical mind wants to merge with my feeling body so allowing that I ‘feel’ that the article is basically fake news meant to provoke fear. It follows a pattern I’ve seen many times, whistle blower headline and lacking any in-depth analysis of the geological area. A volcano of that magnitude is more likely to cause a tsunami than a lot of explosives. I actually don’t think the bastards want to do that … However, never let a good disaster go to waste. It seems to me that population control, ie: mind control is more the agenda than wiping out the Hawaiian Islands or the coast of California. The insanity of building power stations next to volcanoes and nuclear facilities on fault lines is pure hubris and stupidity in spades. </em></p>\r\n<p><em>That said it is likely that fracking is a contributing factor to mother getting pissed off or rather letting off some steam. Unless there is a nuclear device deep under ground a surface explosion would not come anywhere close to provoking a tsunami. What I find interesting when scanning ZeroHedge, which I grok daily to keep a finger on the pulse of the insanity, are the reader comments. The thermal power plant is some five to seven miles inland so as one reader commented: “There is no way a power plant explosion is going to cause a tsunami.  You need vertical movement to the sea bed to accomplish that.” which I my critical mind can make no argument with.\r\n</em></p>\r\n<p><img src=\"http://earthempaths.net/wp/wp-content/uploads/2018/05/Lava-hitting-the-sea.jpg\" alt=\"Lava hitting the sea\" width=\"900\" height=\"600\" /><br><em>Lava reaching the Pacific Ocean</em></p>\r\n<p><em>That something unnatural is occurring, of that I have no doubt for most of humanity is bonded to the unnatural and wouldn’t know real even as it hits them in the face. Even the word natural seems to be losing all context. LOL, maybe it’s time for me to write an article as I seem to be in my sardonic flow.\"\r\n</em></p>\r\n<p>~~~</p>\r\n<p>I write in tone and metaphor that what is happening in Hawaii is a natural event and while the puny humans with big tech toys play around with her mantle she is so much more powerful in her core. Opening the inner eye to a reality that is showing us through the magnificence of her power is stepping into the realm of the 94% of the real that few will ever know. When a volcano erupts or a hurricane churns one would think that we humans would feel the awe of our ancestors for we are living on a planet of extraordinary conception and manifestation. Sadly most are locked into the trivial virtual reality and all is reduced to the next news release. Almost no one seems to be capable of seeing the whole or maintaining any semblance of viewing from a frame of reference that includes geological time. We are being reduced to automatons with predictable responses.</p>\r\n<p>When I see images, I <em>see</em>. A lava flow is a dragon, a plasma creature that is life and as all is consciousness this speaks to me. Perhaps not in the words of prose or linear language but in the emanation of core spirit. I sing a hallelujah inside when Mother demonstrates herself in such splendor. Is she to care for the estates built on her spiny back by ignorant moneyed people, is she to care for the ineptitude of her reckless children when we have cared so little for her?</p>\r\n<p></p>\r\n<p><img src=\"http://earthempaths.net/wp/wp-content/uploads/2018/05/Lava-dragon.jpg\" alt=\"Lava dragon\" width=\"1010\" height=\"682\" /><br><em>Lava Dragon</em></p><br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/21/hawaiis-kilauea-volcano-mothers-caldron-simmers/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.2\",\"image\":[\"\"],\"tags\":[\"awareness\",\"kilauea\",\"metaphor\"]}"
    }
  ]
}
steemdelegated 17.939 SP to @earthempaths
2018/05/21 04:25:42
delegatorsteem
delegateeearthempaths
vesting shares29212.622517 VESTS
Transaction InfoBlock #22614794/Trx 736add71378aac4755af458e86fb491a08505e49
View Raw JSON Data
{
  "trx_id": "736add71378aac4755af458e86fb491a08505e49",
  "block": 22614794,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-21T04:25:42",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "earthempaths",
      "vesting_shares": "29212.622517 VESTS"
    }
  ]
}
2018/05/20 15:53:27
votersensation
authorearthempaths
permlinkthetreeoflife-arwrlean0l
weight10000 (100.00%)
Transaction InfoBlock #22599750/Trx 3bf56b51c78cb34142353863786bccd331458edb
View Raw JSON Data
{
  "trx_id": "3bf56b51c78cb34142353863786bccd331458edb",
  "block": 22599750,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-20T15:53:27",
  "op": [
    "vote",
    {
      "voter": "sensation",
      "author": "earthempaths",
      "permlink": "thetreeoflife-arwrlean0l",
      "weight": 10000
    }
  ]
}
2018/05/20 14:54:30
voterearthempaths
authorearthempaths
permlinkthetreeoflife-arwrlean0l
weight10000 (100.00%)
Transaction InfoBlock #22598571/Trx 293def41f9dbb828528f91746cfe6eddbd311947
View Raw JSON Data
{
  "trx_id": "293def41f9dbb828528f91746cfe6eddbd311947",
  "block": 22598571,
  "trx_in_block": 67,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-20T14:54:30",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "thetreeoflife-arwrlean0l",
      "weight": 10000
    }
  ]
}
2018/05/20 14:54:30
authorearthempaths
permlinkthetreeoflife-arwrlean0l
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #22598571/Trx 293def41f9dbb828528f91746cfe6eddbd311947
View Raw JSON Data
{
  "trx_id": "293def41f9dbb828528f91746cfe6eddbd311947",
  "block": 22598571,
  "trx_in_block": 67,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-20T14:54:30",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "thetreeoflife-arwrlean0l",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2018/05/20 14:54:30
parent author
parent permlinksteempress
authorearthempaths
permlinkthetreeoflife-arwrlean0l
titleThe Tree of Life
bodyWhen I meditate sometimes I get a few visuals and even on occasion some dialogue to go with them. Lately I've been seeing images of a ginormous tree, with branches that extend beyond our atmosphere, and roots that go deep into the center of the earth. At least on an energetic level I get that this tree is as real as real can be. I feel into the flows of energy, with some going deep down into these roots, pulling out the earths nutrients, to nourish the upper branches and leaves. Each and every root has a corresponding branch in the upper world which it is energetically connected to. As the branches with leaves absorb the life giving properties of the sun and utilize the nutrients that the roots provides there is continuous expanding growth. Eventually, as the cycle of life goes, the tree has reached its fullest potential that it was created with, and feels the impetus to begin anew. The fruits it has gathered throughout its experience of expansion have fully ripened, and are now ready to fall from the tree to await the right conditions to sprout and begin the cycle all over again, yet holding the cellular memory of its previous incarnation from before. Not every seed will grow to its full potential, for some do not find hospitable ground to nourish their developing roots, nor sometimes enough access to the life giving properties of the sun to nourish their developing leaves and branches. But nothing is ever lost. It simply changes form. Water. Without water the tree will also die. Water is life, is flow, is present. It is dynamic, it is pregnant with the potential of changing from one form to another with ease. It's the glue that holds it all together, while at the same time it is the lubricant which allows for energy to move. It is present to some degree in all things. When form no longer has access to the life giving properties of water, it simply ceases to exist. But water is eternal, and ever present, whether it can be seen or not. The world tree appears to be dying, but that too is not the only interpretation of what one can see playing out on the world stage. During its long sojourn it has created many seeds. Those seeds are the fruits of the morrow and are almost fully ripened. But one must be patient, lest one pick the fruit too early and it has not had time to develop its natural sweetness to the fullest. And there are always greedy predators who have no regard for the life cycle of the living tree of life. They do not realize that by picking the fruit prematurely they are sealing their own demise. There are always wise ones too, who will guard the trees fruit with vigilance and readiness at all times. For any good farmer knows that growth is dependent on numerous factors, and not every field will be ready for harvest at the same time. And any good farmer knows that to start the cycle anew there must be good seed. One can tune in and almost feel the movement of energy throughout the trees trunk, roots, and branches. Energy moves up the tree to the highest branches and leaves, while at the same time it is moving down the tree into the deepest roots. The energy moves in a spiral and funneling dance that is never static. At its center is the heart of the tree that holds it all together. It is where the well of the waters of life resides. From this deep well all past present and futures are known. And each drop as it ushers forth from the heart, carries with it the full potential of all possibilities of life as it expresses itself in form. The heart takes it all in, transmutes the energies and materials it receives, and sends it all back out in a usable form for the nourishment of the tree. But there loggers who would cut down the tree, without any awareness of its life giving properties to the entire cycle of life in form on this planet called earth. For the earth herself is the heart of the world tree. For this tree to once again flourish there must be more wise ones who will guard the trees fruits with vigilance and readiness at all times. We need more good farmers who will protect the growing fruits from the weeds that threaten to overtake. Weeds, of themselves, are neither good nor bad. They simply do what they do. They grow. And I have noticed that when one fertilizes and waters the tree, the weeds grow better too! I do not wish to eliminate the weeds, simply to remove those who would threaten the growth of the tree. There is plenty of room for weeds, but not in the cultivated garden. Since they are so hardy they do not need the tender nourishment and care needed by the world tree of life. For the tree of life must have love to thrive. It's heart must be kept safe, so that its children the seeds can mature in their own time and way. It needs the space of love, and that is the difference. It's seeds need to be planted with care, and watered, receive sunlight, and have nourishing soil upon which to grow. It needs a gardener who will stay the course. One can not hurry the process with weed killers, or try to make seeds that can resist all challenge, just as the chicken will not hatch properly if it's shell is broken prematurely. No, seeds need infinite patience and trust in the cycle of life, and the waters of creation. Are we not all dreamers at the well of the waters of life? I know I've said this before, but I'll say it again. Dream big. Dream beautiful. Here is a song I learned when I attended the 1999 Svaha Spirit Lodge three day Long Dance event on Orcas Island, in Washington State: Tree of life in the center Tree of life all around Tree of life growing taller Rooted in the ground Tree of life after lifetime Tree of life never dies Tree of earth mother spirit Tree of father sky<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/20/the-tree-of-life/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.2","image":[""],"tags":["steempress","steem"]}
Transaction InfoBlock #22598571/Trx 293def41f9dbb828528f91746cfe6eddbd311947
View Raw JSON Data
{
  "trx_id": "293def41f9dbb828528f91746cfe6eddbd311947",
  "block": 22598571,
  "trx_in_block": 67,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-20T14:54:30",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "earthempaths",
      "permlink": "thetreeoflife-arwrlean0l",
      "title": "The Tree of Life",
      "body": "When I meditate sometimes I get a few visuals and even on occasion some dialogue to go with them. Lately I've been seeing images of a ginormous tree, with branches that extend beyond our atmosphere, and roots that go deep into the center of the earth.\r\n\r\nAt least on an energetic level I get that this tree is as real as real can be. I feel into the flows of energy, with some going deep down into these roots, pulling out the earths nutrients, to nourish the upper branches and leaves. Each and every root has a corresponding branch in the upper world which it is energetically connected to. As the branches with leaves absorb the life giving properties of the sun and utilize the nutrients that the roots provides there is continuous expanding growth.\r\n\r\nEventually, as the cycle of life goes, the tree has reached its fullest potential that it was created with, and feels the impetus to begin anew. The fruits it has gathered throughout its experience of expansion have fully ripened, and are now ready to fall from the tree to await the right conditions to sprout and begin the cycle all over again, yet holding the cellular memory of its previous incarnation from before.\r\n\r\nNot every seed will grow to its full potential, for some do not find hospitable ground to nourish their developing roots, nor sometimes enough access to the life giving properties of the sun to nourish their developing leaves and branches. But nothing is ever lost. It simply changes form.\r\n\r\nWater. Without water the tree will also die. Water is life, is flow, is present. It is dynamic, it is pregnant with the potential of changing from one form to another with ease. It's the glue that holds it all together, while at the same time it is the lubricant which allows for energy to move. It is present to some degree in all things. When form no longer has access to the life giving properties of water, it simply ceases to exist. But water is eternal, and ever present, whether it can be seen or not.\r\n\r\nThe world tree appears to be dying, but that too is not the only interpretation of what one can see playing out on the world stage. During its long sojourn it has created many seeds. Those seeds are the fruits of the morrow and are almost fully ripened. But one must be patient, lest one pick the fruit too early and it has not had time to develop its natural sweetness to the fullest. And there are always greedy predators who have no regard for the life cycle of the living tree of life. They do not realize that by picking the fruit prematurely they are sealing their own demise. There are always wise ones too, who will guard the trees fruit with vigilance and readiness at all times. For any good farmer knows that growth is dependent on numerous factors, and not every field will be ready for harvest at the same time. And any good farmer knows that to start the cycle anew there must be good seed.\r\n\r\nOne can tune in and almost feel the movement of energy throughout the trees trunk, roots, and branches. Energy moves up the tree to the highest branches and leaves, while at the same time it is moving down the tree into the deepest roots. The energy moves in a spiral and funneling dance that is never static. At its center is the heart of the tree that holds it all together. It is where the well of the waters of life resides. From this deep well all past present and futures are known. And each drop as it ushers forth from the heart, carries with it the full potential of all possibilities of life as it expresses itself in form. The heart takes it all in, transmutes the energies and materials it receives, and sends it all back out in a usable form for the nourishment of the tree.\r\n\r\nBut there loggers who would cut down the tree, without any awareness of its life giving properties to the entire cycle of life in form on this planet called earth. For the earth herself is the heart of the world tree. For this tree to once again flourish there must be more wise ones who will guard the trees fruits with vigilance and readiness at all times. We need more good farmers who will protect the growing fruits from the weeds that threaten to overtake. Weeds, of themselves, are neither good nor bad. They simply do what they do. They grow. And I have noticed that when one fertilizes and waters the tree, the weeds grow better too! I do not wish to eliminate the weeds, simply to remove those who would threaten the growth of the tree. There is plenty of room for weeds, but not in the cultivated garden. Since they are so hardy they do not need the tender nourishment and care needed by the world tree of life. For the tree of life must have love to thrive. It's heart must be kept safe, so that its children the seeds can mature in their own time and way.\r\n\r\nIt needs the space of love, and that is the difference. It's seeds need to be planted with care, and watered, receive sunlight, and have nourishing soil upon which to grow. It needs a gardener who will stay the course. One can not hurry the process with weed killers, or try to make seeds that can resist all challenge, just as the chicken will not hatch properly if it's shell is broken prematurely. No, seeds need infinite patience and trust in the cycle of life, and the waters of creation. Are we not all dreamers at the well of the waters of life? I know I've said this before, but I'll say it again. Dream big. Dream beautiful.\r\n\r\nHere is a song I learned when I attended the 1999 Svaha Spirit Lodge three day Long Dance event on Orcas Island, in Washington State:\r\n\r\nTree of life in the center\r\nTree of life all around\r\nTree of life growing taller\r\nRooted in the ground\r\n\r\nTree of life after lifetime\r\nTree of life never dies\r\nTree of earth mother spirit\r\nTree of father sky<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/20/the-tree-of-life/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.2\",\"image\":[\"\"],\"tags\":[\"steempress\",\"steem\"]}"
    }
  ]
}
2018/05/12 13:16:24
voterzhutan
authorearthempaths
permlinknancyannandersonadaughterstributetohermother-zz5use5g4p
weight10000 (100.00%)
Transaction InfoBlock #22366242/Trx c5cd4271997bb485a9b6edb9f526f7e890e85779
View Raw JSON Data
{
  "trx_id": "c5cd4271997bb485a9b6edb9f526f7e890e85779",
  "block": 22366242,
  "trx_in_block": 36,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-12T13:16:24",
  "op": [
    "vote",
    {
      "voter": "zhutan",
      "author": "earthempaths",
      "permlink": "nancyannandersonadaughterstributetohermother-zz5use5g4p",
      "weight": 10000
    }
  ]
}
2018/05/12 13:14:06
voterubg
authorearthempaths
permlinknancyannandersonadaughterstributetohermother-zz5use5g4p
weight100 (1.00%)
Transaction InfoBlock #22366196/Trx f895d3a15c9adf3a7dfe09dabd27ba594552dfa7
View Raw JSON Data
{
  "trx_id": "f895d3a15c9adf3a7dfe09dabd27ba594552dfa7",
  "block": 22366196,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-12T13:14:06",
  "op": [
    "vote",
    {
      "voter": "ubg",
      "author": "earthempaths",
      "permlink": "nancyannandersonadaughterstributetohermother-zz5use5g4p",
      "weight": 100
    }
  ]
}
2018/05/12 13:13:18
voterax3
authorearthempaths
permlinknancyannandersonadaughterstributetohermother-zz5use5g4p
weight100 (1.00%)
Transaction InfoBlock #22366180/Trx 54f2da804ee264843a83f68721e008ac04aeb630
View Raw JSON Data
{
  "trx_id": "54f2da804ee264843a83f68721e008ac04aeb630",
  "block": 22366180,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-12T13:13:18",
  "op": [
    "vote",
    {
      "voter": "ax3",
      "author": "earthempaths",
      "permlink": "nancyannandersonadaughterstributetohermother-zz5use5g4p",
      "weight": 100
    }
  ]
}
2018/05/12 13:13:06
voterearthempaths
authorearthempaths
permlinknancyannandersonadaughterstributetohermother-zz5use5g4p
weight10000 (100.00%)
Transaction InfoBlock #22366176/Trx dc5164cbff854f177f18e7ba0c1cc6d3805af319
View Raw JSON Data
{
  "trx_id": "dc5164cbff854f177f18e7ba0c1cc6d3805af319",
  "block": 22366176,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-12T13:13:06",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "nancyannandersonadaughterstributetohermother-zz5use5g4p",
      "weight": 10000
    }
  ]
}
2018/05/12 13:13:06
authorearthempaths
permlinknancyannandersonadaughterstributetohermother-zz5use5g4p
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #22366176/Trx dc5164cbff854f177f18e7ba0c1cc6d3805af319
View Raw JSON Data
{
  "trx_id": "dc5164cbff854f177f18e7ba0c1cc6d3805af319",
  "block": 22366176,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-12T13:13:06",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "nancyannandersonadaughterstributetohermother-zz5use5g4p",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2018/05/12 13:13:06
parent author
parent permlinksteempress
authorearthempaths
permlinknancyannandersonadaughterstributetohermother-zz5use5g4p
titleNancy Ann Anderson | A Daughter's Tribute to Her Mother
body<p><em>She's been swimming in a turbulent sea of emotions and memories these past weeks, not knowing where she will come ashore. In moments while riding the crest of a wave she sees far ahead, then slides down into the deeper waters of self, shifting through the sands of time finding the will to be free. </em></p> <p>Memories surface and then subside, each one a hook to the past; to that which we hold on to and that which holds on to us. This should have been expected but it was not; to find how deeply rooted memories are and most poignantly with my mother whose DNA I share. Over a month spent emptying out cupboards and closets, going through hundreds of files and photo albums came with a surprising amount of weight... My lineage is wrapped up in these mementos of her long life and with each one comes a subtle pull to be the continuation of my mother's life.</p> <p>An immersion in her memories also opened the pathway for my own past to come flooding back through the hundreds of photos of my earlier life. She was an ardent snapshot taker, one of her proclivities that irritated me early on and one I finally accepted.  There truly is something to be comprehended as to why native people don't like their photos taken, they do hold little pieces of your soul captured for all time, frozen screens of memory.</p> <p><em>She takes a deep sigh of relief to be writing these words for it is her way to let go further, to open a clear space that expands to unknown possibilities and once again to find true comfort in the flow of the Universal now.</em></p> <p>Losing a parent is an experience that defies words to describe the passage, there is the surface grief, the missing of moments spent together in deep conversation, sharing with our hearts and minds as we melded our differing points of view. I miss her and often think during the day how much I would like to share an event or a revelation with her. She always beamed pure joy when I was happy, this was her gift to her daughter in these last years of her life for I had finally allowed myself to be her child again. During her last hours on earth I found myself whispering in her ear while kissing her forehead; "I love you mama."</p> <p>It wasn't always that easy to say for any amount of honesty knows that parental-child relationships are not easy, they are often the grinding stone of who we choose to become. My early years growing up in a household of emotional upheaval prompted me to take on the role of adult very early. There is no need to speak in detail for it is a common ground many have walked. What I can say with an equal honesty is that I was blessed in ways seldom experienced. Blessed by a woman, my mother who in the final years of her life became the unconditional love she had sought her whole life. Blessed by her abundant giving nature, by her truthful rejoicing in other's happiness, by her giving me a home when I needed one and showing me the light of her being unfettered by any demands. Blessed to be her daughter.</p> <p>Being a child to a woman who fought hard to find herself was not an easy way to grow up and while I hesitate to bring a light to her challenges and those our small family endured yet it feels remiss to not do so. People are entrained to only recall the good, and most people only knew my mother as the wise woman she became. Like all of us she had her  inner dilemmas, her proclivities and her challenges for this is what makes a life full, the all of it not just the blessings and good deeds. For who among us has not had to overcome themselves along this short journey called life.</p> <p>What matter most though is that she left a <em>Legacy of Love</em>, for when all is stripped away there shines a light of pure joy and this is the most enduring memory of my mother, Nana, as she was loving called in our family. From an early age I had always known I would be at her side when she made her final transition and as I grew into my own wisdom it became a deep calling of my spirit to accompany her as she took her last breaths. Her spirit sailed high without hesitation and she was met by a circle of radiant beings who gave her passage. Chills and tears still run through my body as I relive this moment, having heard her whisper to me with gentle tears of joy rising in her eyes; "I am free." was the perfecting completion of our life together.</p> <p>~~~</p> <p>My mother made her transition from the earthly realm on April 1, 2018, Easter Sunday and a full moon. As I sit her finding a few moments to re-capture the astounding gifts of Spirit, her spirit and that of the Great Spirit that filled the space around her as she shed her identity, as she let go of all that concerned her was one of the most profound experiences of my life.</p> <p></p> <p><img src="http://earthempaths.net/wp/wp-content/uploads/2018/05/Young-Nancy-circa-1970-e1525268664874-768x1024.jpg" alt="Young Nancy circa 1970" width="768" height="1024" /><br><em>The beautiful determinate spirit of Nancy Ann Anderson Wessell shows in her eyes.</em></p> <p></p> <p>Nancy Ann Anderson (October 1, 1930 – April 1, 2018)</p> <p>The Reverend Nancy Anderson made her transition in the evening of Easter Sunday. There is much sorrow in her passing and yet she left us in great joy. A friend to all she would always offer a hand to help in whatever manner she was called to. She left a legacy of love. For all who were blessed with knowing her in this life and felt the power of her determinate nature of all-inclusive love will rejoice that all was returned to her in her final days on this Earth. Her final words were; “I am overflowing with love.”</p> <p>She is survived by her three children, Christine, Mark and David and her beloved grandchildren, Amber, Amy, Alexia, Conor, John, Tyler and Victoria.</p> <p>Nancy moved to San Miguel de Allende in 2003 with her, now deceased husband, Owen Thomas, together they set about initiating prayer circles and working diligently to promote world peace and the well being of all people. Those who attended her services and took spiritual counsel with her dearly love her. For many years, every Tuesday morning, Rev. Nancy led a spiritual and meditation group at the Empowerment Center.  She was a spiritual mother to many.</p> <p>An ordained minister of Religious Science International she expanded from these teachings and became a vital force with other international groups that taught and promoted the fundamental concept of unity in diversity. This was her passion in the last years of her life.</p> <p>We all will miss her and yet she would ask us to be in the joy and peace she is… Ernest Holmes was one of her first teachers and she would wholeheartedly agree with this quote, so it is.</p> <em>“Life is infinite energy coupled with limitless creative imagination. It is the invisible essence and substance of every visible form. Its nature is goodness, truth, wisdom and beauty, as well as energy and imagination. Our highest satisfaction comes from a sense of conscious union with this invisible Life. All human endeavor is an attempt to get back to first principles, to find such an inward wholeness that all sense of fear, doubt, and uncertainty vanishes.” </em> <p><em>― Ernest Holmes, The Art of Life</em></p> <p></p> <p><img src="http://earthempaths.net/wp/wp-content/uploads/2018/05/Nana-in-prayer.JPG-1024x888.jpg" alt="Nana in prayer.JPG" width="800" height="694" /><br><em>Nana in total surrender to prayer.</em></p><br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/12/nancy-ann-anderson-a-daughters-tribute-to-her-mother/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.2","image":[""],"tags":["steempress","steem"]}
Transaction InfoBlock #22366176/Trx dc5164cbff854f177f18e7ba0c1cc6d3805af319
View Raw JSON Data
{
  "trx_id": "dc5164cbff854f177f18e7ba0c1cc6d3805af319",
  "block": 22366176,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-05-12T13:13:06",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "earthempaths",
      "permlink": "nancyannandersonadaughterstributetohermother-zz5use5g4p",
      "title": "Nancy Ann Anderson | A Daughter's Tribute to Her Mother",
      "body": "<p><em>She's been swimming in a turbulent sea of emotions and memories these past weeks, not knowing where she will come ashore. In moments while riding the crest of a wave she sees far ahead, then slides down into the deeper waters of self, shifting through the sands of time finding the will to be free. </em></p>\r\n<p>Memories surface and then subside, each one a hook to the past; to that which we hold on to and that which holds on to us. This should have been expected but it was not; to find how deeply rooted memories are and most poignantly with my mother whose DNA I share. Over a month spent emptying out cupboards and closets, going through hundreds of files and photo albums came with a surprising amount of weight... My lineage is wrapped up in these mementos of her long life and with each one comes a subtle pull to be the continuation of my mother's life.</p>\r\n<p>An immersion in her memories also opened the pathway for my own past to come flooding back through the hundreds of photos of my earlier life. She was an ardent snapshot taker, one of her proclivities that irritated me early on and one I finally accepted.  There truly is something to be comprehended as to why native people don't like their photos taken, they do hold little pieces of your soul captured for all time, frozen screens of memory.</p>\r\n<p><em>She takes a deep sigh of relief to be writing these words for it is her way to let go further, to open a clear space that expands to unknown possibilities and once again to find true comfort in the flow of the Universal now.</em></p>\r\n<p>Losing a parent is an experience that defies words to describe the passage, there is the surface grief, the missing of moments spent together in deep conversation, sharing with our hearts and minds as we melded our differing points of view. I miss her and often think during the day how much I would like to share an event or a revelation with her. She always beamed pure joy when I was happy, this was her gift to her daughter in these last years of her life for I had finally allowed myself to be her child again. During her last hours on earth I found myself whispering in her ear while kissing her forehead; \"I love you mama.\"</p>\r\n<p>It wasn't always that easy to say for any amount of honesty knows that parental-child relationships are not easy, they are often the grinding stone of who we choose to become. My early years growing up in a household of emotional upheaval prompted me to take on the role of adult very early. There is no need to speak in detail for it is a common ground many have walked. What I can say with an equal honesty is that I was blessed in ways seldom experienced. Blessed by a woman, my mother who in the final years of her life became the unconditional love she had sought her whole life. Blessed by her abundant giving nature, by her truthful rejoicing in other's happiness, by her giving me a home when I needed one and showing me the light of her being unfettered by any demands. Blessed to be her daughter.</p>\r\n<p>Being a child to a woman who fought hard to find herself was not an easy way to grow up and while I hesitate to bring a light to her challenges and those our small family endured yet it feels remiss to not do so. People are entrained to only recall the good, and most people only knew my mother as the wise woman she became. Like all of us she had her  inner dilemmas, her proclivities and her challenges for this is what makes a life full, the all of it not just the blessings and good deeds. For who among us has not had to overcome themselves along this short journey called life.</p>\r\n<p>What matter most though is that she left a <em>Legacy of Love</em>, for when all is stripped away there shines a light of pure joy and this is the most enduring memory of my mother, Nana, as she was loving called in our family. From an early age I had always known I would be at her side when she made her final transition and as I grew into my own wisdom it became a deep calling of my spirit to accompany her as she took her last breaths. Her spirit sailed high without hesitation and she was met by a circle of radiant beings who gave her passage. Chills and tears still run through my body as I relive this moment, having heard her whisper to me with gentle tears of joy rising in her eyes; \"I am free.\" was the perfecting completion of our life together.</p>\r\n<p>~~~</p>\r\n<p>My mother made her transition from the earthly realm on April 1, 2018, Easter Sunday and a full moon. As I sit her finding a few moments to re-capture the astounding gifts of Spirit, her spirit and that of the Great Spirit that filled the space around her as she shed her identity, as she let go of all that concerned her was one of the most profound experiences of my life.</p>\r\n<p></p>\r\n<p><img src=\"http://earthempaths.net/wp/wp-content/uploads/2018/05/Young-Nancy-circa-1970-e1525268664874-768x1024.jpg\" alt=\"Young Nancy circa 1970\" width=\"768\" height=\"1024\" /><br><em>The beautiful determinate spirit of Nancy Ann Anderson Wessell shows in her eyes.</em></p>\r\n<p></p>\r\n<p>Nancy Ann Anderson (October 1, 1930 – April 1, 2018)</p>\r\n<p>The Reverend Nancy Anderson made her transition in the evening of Easter Sunday. There is much sorrow in her passing and yet she left us in great joy. A friend to all she would always offer a hand to help in whatever manner she was called to. She left a legacy of love. For all who were blessed with knowing her in this life and felt the power of her determinate nature of all-inclusive love will rejoice that all was returned to her in her final days on this Earth. Her final words were; “I am overflowing with love.”</p>\r\n<p>She is survived by her three children, Christine, Mark and David and her beloved grandchildren, Amber, Amy, Alexia, Conor, John, Tyler and Victoria.</p>\r\n<p>Nancy moved to San Miguel de Allende in 2003 with her, now deceased husband, Owen Thomas, together they set about initiating prayer circles and working diligently to promote world peace and the well being of all people. Those who attended her services and took spiritual counsel with her dearly love her. For many years, every Tuesday morning, Rev. Nancy led a spiritual and meditation group at the Empowerment Center.  She was a spiritual mother to many.</p>\r\n<p>An ordained minister of Religious Science International she expanded from these teachings and became a vital force with other international groups that taught and promoted the fundamental concept of unity in diversity. This was her passion in the last years of her life.</p>\r\n<p>We all will miss her and yet she would ask us to be in the joy and peace she is… Ernest Holmes was one of her first teachers and she would wholeheartedly agree with this quote, so it is.</p>\r\n<em>“Life is infinite energy coupled with limitless creative imagination. It is the invisible essence and substance of every visible form. Its nature is goodness, truth, wisdom and beauty, as well as energy and imagination. Our highest satisfaction comes from a sense of conscious union with this invisible Life. All human endeavor is an attempt to get back to first principles, to find such an inward wholeness that all sense of fear, doubt, and uncertainty vanishes.” </em>\r\n<p><em>― Ernest Holmes, The Art of Life</em></p>\r\n<p></p>\r\n<p><img src=\"http://earthempaths.net/wp/wp-content/uploads/2018/05/Nana-in-prayer.JPG-1024x888.jpg\" alt=\"Nana in prayer.JPG\" width=\"800\" height=\"694\" /><br><em>Nana in total surrender to prayer.</em></p><br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/05/12/nancy-ann-anderson-a-daughters-tribute-to-her-mother/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.2\",\"image\":[\"\"],\"tags\":[\"steempress\",\"steem\"]}"
    }
  ]
}
2018/04/18 19:22:12
voterearthempaths
authorearthempaths
permlinkwhatislove-xq8jhm0sbe
weight10000 (100.00%)
Transaction InfoBlock #21683147/Trx 3495adefbb08e331ea859c5e3ab57fcfa881d1fb
View Raw JSON Data
{
  "trx_id": "3495adefbb08e331ea859c5e3ab57fcfa881d1fb",
  "block": 21683147,
  "trx_in_block": 48,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-04-18T19:22:12",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "whatislove-xq8jhm0sbe",
      "weight": 10000
    }
  ]
}
2018/04/18 19:22:12
authorearthempaths
permlinkwhatislove-xq8jhm0sbe
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #21683147/Trx 3495adefbb08e331ea859c5e3ab57fcfa881d1fb
View Raw JSON Data
{
  "trx_id": "3495adefbb08e331ea859c5e3ab57fcfa881d1fb",
  "block": 21683147,
  "trx_in_block": 48,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-04-18T19:22:12",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "whatislove-xq8jhm0sbe",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
earthempathspublished a new post: whatislove-xq8jhm0sbe
2018/04/18 19:22:12
parent author
parent permlinksteempress
authorearthempaths
permlinkwhatislove-xq8jhm0sbe
titleWhat is Love?
bodyWhat is Love? What I am about to write about is deeply personal, and yet, I know the concepts of what I speak are universal. We all want to know, in some form or fashion (except for the true narcissist who already has figured out they are here to take, i.e. the satanic concept of do what thou wilt, without regard for whether that involves lies, subterfuge, and blatant deception, or the hurt inflicted on others) what we are really here for, the why of it all. For many that leads down the path of organized religion. Others look to science for the answers to life's questions, and some use a more multifaceted approach that is more akin to what I consider the spiritual outlook. And when I say spiritual, I really just mean the even scientifically understood concept that everything is energy, rotating at different speeds and with different partners, to form the building blocks of all life. You can call them elements or the elementals, and the properties they each have, and how they form bonds with each other to create the forms we see here everywhere we look. That includes all life forms, from plants, animals, aquatic life, and humans, to trees, rocks, dirt, air, and water, to name just a few. In short, biological life is formed by tiny little universes forming to create matter in the first place. Everything, really, is imbued with consciousness. And, the big kicker in all this, is that everything, so far as I have found, is able to communicate with us. I think as children we still understand this, the magical foundation of everything that is, and have it programmed out of us as we grow, on purpose. But I'll get more into that as I go along. I know what I just wrote above is not mainstream and is not even understandable to some. I might as well be speaking gibberish. I don't know what to say, but I do know that my current outlook, to some extent, goes all the way back to some childhood memories that still have a powerful influence over my life. As I have stated before, life started out for me in a way that, along with the baggage I brought in with me unawares, predisposed me to some personality attributes that brought about a lot of misery. It doesn't matter anymore who did what or why, or what my story is. What does matter is that I as I continued to refine my ability to self reflect, paying attention to my inner dialog, and opening a line of communication to understand my inner workings better, I realized that I hated myself, didn't think I deserved to have love, or be happy. I realized I engaged in a lot of self sabotaging behaviors. As I continued to try and get a grip and find a way to make life work for me, I found myself in many situations where I continued to create what I had grown accustomed to, regardless of my conscious desire to experience something different. Problem was, my subconscious terrain was akin to a minefield, and I only seemed to go there when under duress. All I could seem to do was react in ways that were not conducive to positive change, and then feel tremendous guilt over my lack of emotional control when I later re-emerged from my dungeon of inner darkness. In part, maybe the extreme sense of discomfort I felt within my own body is what stimulated me to be so driven to change, to put forth the effort needed to learn how to be happy. And yes, joy and happiness do go with learning how to choose love first. But I'm getting ahead of myself again. The other thing that stimulated me on this path is what I experienced that falls into the woo woo category. It started out with memories of trying to climb the walls from my crib at around 18 months to 2 years old, to memories of being taken out my bedroom window on a white horse with wings to a high mountain cliff only assessable by air. I won't go into the whole story again, except to say that further memories have come forward that have added another layer to the experience, and made me realize I really don't know what happened to me with any clarity. In short, in some form or fashion I was messed with, and these experiences have made me feel "different", and "weird", my whole life. It seems I was traumatized in these experiences and have had to heal and work through the emotional residue as part of my journey to recover a working understanding, a retrieval of sorts, of what was lost along the way. At the same time this was going on, I had a completely different level of experience that seemed to be happening simultaneous to the trauma. These memories have also stayed with my whole life, and have caused me to seek understanding as well. It would seem to me that we have access, at all times really, to both heaven and hell, both the light and the dark. And I have retrained myself to reach for the higher plain. Even though I wake up daily with ever greater awareness of the anti life forces at work here in this shared reality, this overlaid blanket of deceit and perpetual shadowlands lurking in plain sight though mostly remaining unseen, I have found that after releasing much of the residual pockets of inflicted traumas designed to disempower and harm, I can access that higher ground with much greater ease than before. But I have had to subject myself to great feelings of discomfort. And that comes back to the effort it takes to reprogram yourself to become comfortable with normal, with stable, with kind, with loving people whom you really can trust in your life. To become comfortable with slow, to embracing challenges with faith in yourself, and trust in the goodness that is equally available in each moment, in each trial, and in each seeming error of judgement. I know this is all just words, and nothing will ever take away from the hard work necessary that each must do on their own in their own individual way. But I am in awe, and in deep gratitude, for whatever it was that really happened to me as a child that predisposed me to taking this route in life. Whatever it was that day, standing in the driveway, embracing me in a blanket of loving energy that defies explanation and can't be conveyed in words, that told me "you are loved, always and forever, just as you are" I cannot and don't want to imagine what it would have been like to have not have that experience to draw from and expand on. My whole life is a testament to the power of love to transform. And it is an inside job, that has the potential to radiate out in ever expanding circles, in a way that may come quietly, but is ever more powerful than all the hate and evil in this world put together. It IS the energy of creation. It has made me want to be a better person, to keep trying when I want to quit, to keep reaching out there when I want I go and hide from the world. It is what makes it all worth while. To me, this is my best explanation of love. It is a choice, it is a way of life you can grow into, and it doesn't take anything but trust, faith, courage, and a willingness to be at least honest with yourself. The ego is not our enemy, it just doesn't deserve the position of running our lives. It is too easy to be manipulated into living a life that is never going to bring satisfaction, true happiness, and the opportunity to know what love is. Love is real, it's not an emotion, but it is reflected in what you do. And sometimes it's just plain hard work, to stay in that place, or pick yourself up when you realize you may have taken a wrong turn. But I truly do think it's what fuels creation itself, and there is no place I'd rather be than on the edge of the incoming wave of love in action. I feel I have more to add to this, but for now I will just leave this here, with the hopes that someone else who maybe needs to hear these words will find them. I know as I went outside this morning I felt that presence again, that something so big, so wonderful. And I do so wish I had a magic wand sometimes to take away the pain that so many do not want to feel, that they drag around with themselves like a ball and chain. Love may hurt sometimes, but it never feels heavy. It may bring tears, but they too only water and make fertile the soil for more love to grow. Love, like water, can move mountains if you let it. It certainly has with me, and I am in awe and grateful beyond words. Aho<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/04/18/what-is-love/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.2","image":[""],"tags":["steempress","steem"]}
Transaction InfoBlock #21683147/Trx 3495adefbb08e331ea859c5e3ab57fcfa881d1fb
View Raw JSON Data
{
  "trx_id": "3495adefbb08e331ea859c5e3ab57fcfa881d1fb",
  "block": 21683147,
  "trx_in_block": 48,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-04-18T19:22:12",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "earthempaths",
      "permlink": "whatislove-xq8jhm0sbe",
      "title": "What is Love?",
      "body": "What is Love?\r\n\r\nWhat I am about to write about is deeply personal, and yet, I know the concepts of what I speak are universal. We all want to know, in some form or fashion (except for the true narcissist who already has figured out they are here to take, i.e. the satanic concept of do what thou wilt, without regard for whether that involves lies, subterfuge, and blatant deception, or the hurt inflicted on others) what we are really here for, the why of it all. For many that leads down the path of organized religion. Others look to science for the answers to life's questions, and some use a more multifaceted approach that is more akin to what I consider the spiritual outlook.\r\n\r\nAnd when I say spiritual, I really just mean the even scientifically understood concept that everything is energy, rotating at different speeds and with different partners, to form the building blocks of all life. You can call them elements or the elementals, and the properties they each have, and how they form bonds with each other to create the forms we see here everywhere we look. That includes all life forms, from plants, animals, aquatic life, and humans, to trees, rocks, dirt, air, and water, to name just a few. In short, biological life is formed by tiny little universes forming to create matter in the first place. Everything, really, is imbued with consciousness. And, the big kicker in all this, is that everything, so far as I have found, is able to communicate with us. I think as children we still understand this, the magical foundation of everything that is, and have it programmed out of us as we grow, on purpose. But I'll get more into that as I go along.\r\n\r\nI know what I just wrote above is not mainstream and is not even understandable to some. I might as well be speaking gibberish. I don't know what to say, but I do know that my current outlook, to some extent, goes all the way back to some childhood memories that still have a powerful influence over my life. As I have stated before, life started out for me in a way that, along with the baggage I brought in with me unawares, predisposed me to some personality attributes that brought about a lot of misery. It doesn't matter anymore who did what or why, or what my story is. What does matter is that I as I continued to refine my ability to self reflect, paying attention to my inner dialog, and opening a line of communication to understand my inner workings better, I realized that I hated myself, didn't think I deserved to have love, or be happy. I realized I engaged in a lot of self sabotaging behaviors. As I continued to try and get a grip and find a way to make life work for me, I found myself in many situations where I continued to create what I had grown accustomed to, regardless of my conscious desire to experience something different. Problem was, my subconscious terrain was akin to a minefield, and I only seemed to go there when under duress. All I could seem to do was react in ways that were not conducive to positive change, and then feel tremendous guilt over my lack of emotional control when I later re-emerged from my dungeon of inner darkness.\r\n\r\nIn part, maybe the extreme sense of discomfort I felt within my own body is what stimulated me to be so driven to change, to put forth the effort needed to learn how to be happy. And yes, joy and happiness do go with learning how to choose love first. But I'm getting ahead of myself again. The other thing that stimulated me on this path is what I experienced that falls into the woo woo category. It started out with memories of trying to climb the walls from my crib at around 18 months to 2 years old, to memories of being taken out my bedroom window on a white horse with wings to a high mountain cliff only assessable by air. I won't go into the whole story again, except to say that further memories have come forward that have added another layer to the experience, and made me realize I really don't know what happened to me with any clarity. In short, in some form or fashion I was messed with, and these experiences have made me feel \"different\", and \"weird\", my whole life. It seems I was traumatized in these experiences and have had to heal and work through the emotional residue as part of my journey to recover a working understanding, a retrieval of sorts, of what was lost along the way. At the same time this was going on, I had a completely different level of experience that seemed to be happening simultaneous to the trauma. These memories have also stayed with my whole life, and have caused me to seek understanding as well.\r\n\r\nIt would seem to me that we have access, at all times really, to both heaven and hell, both the light and the dark. And I have retrained myself to reach for the higher plain. Even though I wake up daily with ever greater awareness of the anti life forces at work here in this shared reality, this overlaid blanket of deceit and perpetual shadowlands lurking in plain sight though mostly remaining unseen, I have found that after releasing much of the residual pockets of inflicted traumas designed to disempower and harm, I can access that higher ground with much greater ease than before. But I have had to subject myself to great feelings of discomfort. And that comes back to the effort it takes to reprogram yourself to become comfortable with normal, with stable, with kind, with loving people whom you really can trust in your life. To become comfortable with slow, to embracing challenges with faith in yourself, and trust in the goodness that is equally available in each moment, in each trial, and in each seeming error of judgement.\r\n\r\nI know this is all just words, and nothing will ever take away from the hard work necessary that each must do on their own in their own individual way. But I am in awe, and in deep gratitude, for whatever it was that really happened to me as a child that predisposed me to taking this route in life. Whatever it was that day, standing in the driveway, embracing me in a blanket of loving energy that defies explanation and can't be conveyed in words, that told me \"you are loved, always and forever, just as you are\" I cannot and don't want to imagine what it would have been like to have not have that experience to draw from and expand on. My whole life is a testament to the power of love to transform. And it is an inside job, that has the potential to radiate out in ever expanding circles, in a way that may come quietly, but is ever more powerful than all the hate and evil in this world put together. It IS the energy of creation. It has made me want to be a better person, to keep trying when I want to quit, to keep reaching out there when I want I go and hide from the world. It is what makes it all worth while.\r\n\r\nTo me, this is my best explanation of love. It is a choice, it is a way of life you can grow into, and it doesn't take anything but trust, faith, courage, and a willingness to be at least honest with yourself. The ego is not our enemy, it just doesn't deserve the position of running our lives. It is too easy to be manipulated into living a life that is never going to bring satisfaction, true happiness, and the opportunity to know what love is. Love is real, it's not an emotion, but it is reflected in what you do. And sometimes it's just plain hard work, to stay in that place, or pick yourself up when you realize you may have taken a wrong turn. But I truly do think it's what fuels creation itself, and there is no place I'd rather be than on the edge of the incoming wave of love in action.\r\n\r\nI feel I have more to add to this, but for now I will just leave this here, with the hopes that someone else who maybe needs to hear these words will find them. I know as I went outside this morning I felt that presence again, that something so big, so wonderful. And I do so wish I had a magic wand sometimes to take away the pain that so many do not want to feel, that they drag around with themselves like a ball and chain. Love may hurt sometimes, but it never feels heavy. It may bring tears, but they too only water and make fertile the soil for more love to grow. Love, like water, can move mountains if you let it. It certainly has with me, and I am in awe and grateful beyond words. Aho<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/04/18/what-is-love/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.2\",\"image\":[\"\"],\"tags\":[\"steempress\",\"steem\"]}"
    }
  ]
}
earthempathsreceived 0.002 STEEM, 0.007 SBD, 0.009 SP author reward for @earthempaths / theimaginalselftheinfinitesimalyou-c20n9l7dzf
2018/04/03 16:39:06
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
sbd payout0.007 SBD
steem payout0.002 STEEM
vesting payout14.276026 VESTS
Transaction InfoBlock #21247944/Virtual Operation #11
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 21247944,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 11,
  "timestamp": "2018-04-03T16:39:06",
  "op": [
    "author_reward",
    {
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "sbd_payout": "0.007 SBD",
      "steem_payout": "0.002 STEEM",
      "vesting_payout": "14.276026 VESTS"
    }
  ]
}
howoreceived 0.000 SP benefactor reward from @earthempaths
2018/04/03 16:39:06
benefactorhowo
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
sbd payout0.000 SBD
steem payout0.000 STEEM
vesting payout0.000000 VESTS
Transaction InfoBlock #21247944/Virtual Operation #10
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 21247944,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 10,
  "timestamp": "2018-04-03T16:39:06",
  "op": [
    "comment_benefactor_reward",
    {
      "benefactor": "howo",
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "sbd_payout": "0.000 SBD",
      "steem_payout": "0.000 STEEM",
      "vesting_payout": "0.000000 VESTS"
    }
  ]
}
fredrikaareceived 0.000 SP benefactor reward from @earthempaths
2018/04/03 16:39:06
benefactorfredrikaa
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
sbd payout0.000 SBD
steem payout0.000 STEEM
vesting payout0.000000 VESTS
Transaction InfoBlock #21247944/Virtual Operation #9
View Raw JSON Data
{
  "trx_id": "0000000000000000000000000000000000000000",
  "block": 21247944,
  "trx_in_block": 4294967295,
  "op_in_trx": 0,
  "virtual_op": 9,
  "timestamp": "2018-04-03T16:39:06",
  "op": [
    "comment_benefactor_reward",
    {
      "benefactor": "fredrikaa",
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "sbd_payout": "0.000 SBD",
      "steem_payout": "0.000 STEEM",
      "vesting_payout": "0.000000 VESTS"
    }
  ]
}
2018/03/27 18:18:03
votersteempress-io
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
weight1181 (11.81%)
Transaction InfoBlock #21048382/Trx b66004a8abb26c84f47424bfa6e08e77d5563b27
View Raw JSON Data
{
  "trx_id": "b66004a8abb26c84f47424bfa6e08e77d5563b27",
  "block": 21048382,
  "trx_in_block": 13,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T18:18:03",
  "op": [
    "vote",
    {
      "voter": "steempress-io",
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "weight": 1181
    }
  ]
}
2018/03/27 17:24:54
voteracutimam
authorearthempaths
permlinkegyptianpyramids-ancienthistory-o1u2v62549
weight10000 (100.00%)
Transaction InfoBlock #21047319/Trx f6791bded19d0e6471196a2508c3b05de9b25bb5
View Raw JSON Data
{
  "trx_id": "f6791bded19d0e6471196a2508c3b05de9b25bb5",
  "block": 21047319,
  "trx_in_block": 27,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T17:24:54",
  "op": [
    "vote",
    {
      "voter": "acutimam",
      "author": "earthempaths",
      "permlink": "egyptianpyramids-ancienthistory-o1u2v62549",
      "weight": 10000
    }
  ]
}
2018/03/27 17:00:51
voterearthempaths
authorearthempaths
permlinkegyptianpyramids-ancienthistory-o1u2v62549
weight10000 (100.00%)
Transaction InfoBlock #21046839/Trx 796efa0ae75628e834cbaca71ad5a7332fb35f12
View Raw JSON Data
{
  "trx_id": "796efa0ae75628e834cbaca71ad5a7332fb35f12",
  "block": 21046839,
  "trx_in_block": 10,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T17:00:51",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "egyptianpyramids-ancienthistory-o1u2v62549",
      "weight": 10000
    }
  ]
}
2018/03/27 17:00:51
authorearthempaths
permlinkegyptianpyramids-ancienthistory-o1u2v62549
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #21046839/Trx 796efa0ae75628e834cbaca71ad5a7332fb35f12
View Raw JSON Data
{
  "trx_id": "796efa0ae75628e834cbaca71ad5a7332fb35f12",
  "block": 21046839,
  "trx_in_block": 10,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T17:00:51",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "egyptianpyramids-ancienthistory-o1u2v62549",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2018/03/27 17:00:51
parent author
parent permlinksteempress
authorearthempaths
permlinkegyptianpyramids-ancienthistory-o1u2v62549
titleEgyptian Pyramids - Ancient History
body<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/03/27/egyptian-pyramids-ancient-history/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.0.1","tags":["steempress","steem"]}
Transaction InfoBlock #21046839/Trx 796efa0ae75628e834cbaca71ad5a7332fb35f12
View Raw JSON Data
{
  "trx_id": "796efa0ae75628e834cbaca71ad5a7332fb35f12",
  "block": 21046839,
  "trx_in_block": 10,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T17:00:51",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "earthempaths",
      "permlink": "egyptianpyramids-ancienthistory-o1u2v62549",
      "title": "Egyptian Pyramids - Ancient History",
      "body": "<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/03/27/egyptian-pyramids-ancient-history/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.0.1\",\"tags\":[\"steempress\",\"steem\"]}"
    }
  ]
}
2018/03/27 16:56:57
voterearthempaths
authorcryptojade
permlinkre-earthempaths-energyfromspacetheshifthasbegun-h6vtmydhw9-20180302t014019366z
weight10000 (100.00%)
Transaction InfoBlock #21046761/Trx 7a487313e3bca3b0bfc99ec0f95a885043572cf3
View Raw JSON Data
{
  "trx_id": "7a487313e3bca3b0bfc99ec0f95a885043572cf3",
  "block": 21046761,
  "trx_in_block": 38,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T16:56:57",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "cryptojade",
      "permlink": "re-earthempaths-energyfromspacetheshifthasbegun-h6vtmydhw9-20180302t014019366z",
      "weight": 10000
    }
  ]
}
2018/03/27 16:39:06
voterearthempaths
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
weight10000 (100.00%)
Transaction InfoBlock #21046404/Trx ab2916d244f71c075a956560e35e80a17cccf554
View Raw JSON Data
{
  "trx_id": "ab2916d244f71c075a956560e35e80a17cccf554",
  "block": 21046404,
  "trx_in_block": 15,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T16:39:06",
  "op": [
    "vote",
    {
      "voter": "earthempaths",
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "weight": 10000
    }
  ]
}
2018/03/27 16:39:06
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"fredrikaa","weight":500},{"account":"howo","weight":500}]}]]
Transaction InfoBlock #21046404/Trx ab2916d244f71c075a956560e35e80a17cccf554
View Raw JSON Data
{
  "trx_id": "ab2916d244f71c075a956560e35e80a17cccf554",
  "block": 21046404,
  "trx_in_block": 15,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T16:39:06",
  "op": [
    "comment_options",
    {
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "fredrikaa",
                "weight": 500
              },
              {
                "account": "howo",
                "weight": 500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2018/03/27 16:39:06
parent author
parent permlinkawareness
authorearthempaths
permlinktheimaginalselftheinfinitesimalyou-c20n9l7dzf
titleThe Imaginal Self | The Infinitesimal You
body<p><em>Author’s Preface:</em> When I write using the third person designation of <em>She</em> it is to evoke the inner silent voice that comes through as an image, at times in thought and in other moments as a full body recognition. <em>She</em> is not alone and she speaks through many, what is brought forth in the linearity of language is an individuated expression from the field of Creation, <em>She</em>.</p> <p>~~~</p> <p><em>She slipped into a dream the other night listening to the eternal coming ashore of the waters of the Pacific ocean. With ease inner sight soared upon the galactic waves of creation. There she saw you in your suit of armor, golden flames and silver plating meeting a Dragon of swirling creation. </em></p> <p><em>She knew not from where you came as the lightening and sparks of that clash continued for a long time, it wasn’t war, it an integral part of what you chose so very long ago. </em></p> <p><em>Thoughts of sacrifice rise though it was more than that, it was the way you answered a call. </em></p> <p>~~~</p> <p>A human Being is aware of the hyperdimensional reality though for most it can only be perceived in linear thought forms expressing in what appears to be disconnected events or endeavors. Slowly through this cycle more are inching toward the inevitable acceptance that all is one and all is connected in the cosmic fields of dynamic exchange.</p> <p>The above looks like big words and concepts as I watch my fingers type and yet once arrived on the shores of your unique infinity they are pointing to an singular infinitesimal reality.</p> <p>Each of us will read a word or words that are strung together from a unique perspective. In writing I try to describe without resorting to over used words like zero point or source I find the infinite within the infinitesimal point. To quote from a translation of <em>The Emerald Tablet of Hermes Trismegistus:</em></p> <p><em>"That which is Below corresponds to that which is Above, and that which is Above corresponds to that which is Below, to accomplish the miracle of the One Thing.” </em></p> <p><em>“Thus, whatever happens on any level of reality also happens on every other level.”</em></p> <p>My simplest way of repeatedly saying the above is that <em>Truth is a straight line</em>, though I will expand a bit on that analogy. For something to be true to course, such as in hitting the mark, it must correspond with all other truths. The internalizing of this is what many call alignment. Rising above the plane of duality and linearity the mystical realms open with the appearance of realities within realities unfolding in a simultaneous presenting now. Thus far there appears to be a gap, a rift that is being mended with each conscious Being refining the inner perspective. Simultaneous events are happening and this is reflected in the outer projection that we see on the world screen. Sadly most still think this is all there is to reality, for the many who will read these words is the depth of comprehension that we have been coerced into spending our most precious substance, energy in navigating the bonds of law and order. So many are unshackling from this that the inevitable is finally being shown on the projection screen. The folly of egos out of control is now captured and seen.</p> <p>The individuated spark of consciousness that resides within every living thing is moving closer to self while it appears that the collective of humanity is moving further away from <em>Self</em>. As we continue to expand our conscious awareness of the Spirit within all things we are also imploding into a separate reality.</p> <p>My ponderings of late have been deep on this subject, individualism vs. collectivism and somewhere there is a meeting of the two dynamics. Inklings of new realities are being written as the chasm widens. Those who choose to stay blinded by the blinding noxious glare of false news as those who fall for the pang of injected fear rally to the call of convenience and the false promise of comfort.</p> <p>It is not so difficult to perceive this for the patterns of deception are always the same, repeating loops of a control grid that is now ringing its death knell. While there are refinements in technologies that are used to intrude into the inner sanctity of the mind there is also a growing Body of Gnosis, both individualized and collective that are forming within an impenetrable field, we can call it Love.</p> <p>True Love is not the romanticized idealized version that is force fed through the glossy superficiality of the big screen, it is the underlying Truth in all things. From our depth studies of astrophysics, esoteric gnosis, biology, cosmology, genealogy, astrology, mysticism, archeology and all the We share in our blossoming to the Cosmic dance.</p> <p><em>Letting go of what was once held in the tight clench of the soul is the imaginal self growing new wings. Become the adept of your Self  True, let go of the rest.</em></p> <p><img src="http://earthempaths.net/wp/wp-content/uploads/2018/03/metamorphosis-1024x768.jpg" alt="metamorphosis" width="800" height="600" /><br><em>Artist: unknown</em></p> <div> <div> <div><em>“Don’t play old tapes. Just cut the very root, just drop the whole idea of old patterns and old habits and start living in a new way. And it is only a question of decision. Once you decide, things start changing, because everything depends on your decision. That is the meaning of the word decision: it means ’it cuts’, decision. It cuts your past, it creates a discontinuity.”</em></div> </div> <div></div> <div>~ Osho</div> </div> <p></p> <p></p> <p></p> <p></p> &nbsp;<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/03/27/the-imaginal-self-the-infinitesimal-you/</em><hr/></center>
json metadata{"community":"steempress","app":"steempress/1.0.1","tags":["awareness","creation","truth","wisdom"]}
Transaction InfoBlock #21046404/Trx ab2916d244f71c075a956560e35e80a17cccf554
View Raw JSON Data
{
  "trx_id": "ab2916d244f71c075a956560e35e80a17cccf554",
  "block": 21046404,
  "trx_in_block": 15,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-27T16:39:06",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "awareness",
      "author": "earthempaths",
      "permlink": "theimaginalselftheinfinitesimalyou-c20n9l7dzf",
      "title": "The Imaginal Self | The Infinitesimal You",
      "body": "<p><em>Author’s Preface:</em> When I write using the third person designation of <em>She</em> it is to evoke the inner silent voice that comes through as an image, at times in thought and in other moments as a full body recognition. <em>She</em> is not alone and she speaks through many, what is brought forth in the linearity of language is an individuated expression from the field of Creation, <em>She</em>.</p>\r\n<p>~~~</p>\r\n<p><em>She slipped into a dream the other night listening to the eternal coming ashore of the waters of the Pacific ocean. With ease inner sight soared upon the galactic waves of creation. There she saw you in your suit of armor, golden flames and silver plating meeting a Dragon of swirling creation. </em></p>\r\n<p><em>She knew not from where you came as the lightening and sparks of that clash continued for a long time, it wasn’t war, it an integral part of what you chose so very long ago. </em></p>\r\n<p><em>Thoughts of sacrifice rise though it was more than that, it was the way you answered a call. </em></p>\r\n<p>~~~</p>\r\n<p>A human Being is aware of the hyperdimensional reality though for most it can only be perceived in linear thought forms expressing in what appears to be disconnected events or endeavors. Slowly through this cycle more are inching toward the inevitable acceptance that all is one and all is connected in the cosmic fields of dynamic exchange.</p>\r\n<p>The above looks like big words and concepts as I watch my fingers type and yet once arrived on the shores of your unique infinity they are pointing to an singular infinitesimal reality.</p>\r\n<p>Each of us will read a word or words that are strung together from a unique perspective. In writing I try to describe without resorting to over used words like zero point or source I find the infinite within the infinitesimal point. To quote from a translation of <em>The Emerald Tablet of Hermes Trismegistus:</em></p>\r\n<p><em>\"That which is Below corresponds to that which is Above, and that which is Above corresponds to that which is Below, to accomplish the miracle of the One Thing.” </em></p>\r\n<p><em>“Thus, whatever happens on any level of reality also happens on every other level.”</em></p>\r\n<p>My simplest way of repeatedly saying the above is that <em>Truth is a straight line</em>, though I will expand a bit on that analogy. For something to be true to course, such as in hitting the mark, it must correspond with all other truths. The internalizing of this is what many call alignment. Rising above the plane of duality and linearity the mystical realms open with the appearance of realities within realities unfolding in a simultaneous presenting now. Thus far there appears to be a gap, a rift that is being mended with each conscious Being refining the inner perspective. Simultaneous events are happening and this is reflected in the outer projection that we see on the world screen. Sadly most still think this is all there is to reality, for the many who will read these words is the depth of comprehension that we have been coerced into spending our most precious substance, energy in navigating the bonds of law and order. So many are unshackling from this that the inevitable is finally being shown on the projection screen. The folly of egos out of control is now captured and seen.</p>\r\n<p>The individuated spark of consciousness that resides within every living thing is moving closer to self while it appears that the collective of humanity is moving further away from <em>Self</em>. As we continue to expand our conscious awareness of the Spirit within all things we are also imploding into a separate reality.</p>\r\n<p>My ponderings of late have been deep on this subject, individualism vs. collectivism and somewhere there is a meeting of the two dynamics. Inklings of new realities are being written as the chasm widens. Those who choose to stay blinded by the blinding noxious glare of false news as those who fall for the pang of injected fear rally to the call of convenience and the false promise of comfort.</p>\r\n<p>It is not so difficult to perceive this for the patterns of deception are always the same, repeating loops of a control grid that is now ringing its death knell. While there are refinements in technologies that are used to intrude into the inner sanctity of the mind there is also a growing Body of Gnosis, both individualized and collective that are forming within an impenetrable field, we can call it Love.</p>\r\n<p>True Love is not the romanticized idealized version that is force fed through the glossy superficiality of the big screen, it is the underlying Truth in all things. From our depth studies of astrophysics, esoteric gnosis, biology, cosmology, genealogy, astrology, mysticism, archeology and all the We share in our blossoming to the Cosmic dance.</p>\r\n<p><em>Letting go of what was once held in the tight clench of the soul is the imaginal self growing new wings. Become the adept of your Self  True, let go of the rest.</em></p>\r\n<p><img src=\"http://earthempaths.net/wp/wp-content/uploads/2018/03/metamorphosis-1024x768.jpg\" alt=\"metamorphosis\" width=\"800\" height=\"600\" /><br><em>Artist: unknown</em></p>\r\n\r\n<div>\r\n<div>\r\n<div><em>“Don’t play old tapes. Just cut the very root, just drop the whole idea of old patterns and old habits and start living in a new way. And it is only a question of decision. Once you decide, things start changing, because everything depends on your decision. That is the meaning of the word decision: it means ’it cuts’, decision. It cuts your past, it creates a discontinuity.”</em></div>\r\n</div>\r\n<div></div>\r\n<div>~ Osho</div>\r\n</div>\r\n<p></p>\r\n<p></p>\r\n<p></p>\r\n<p></p>\r\n&nbsp;<br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://earthempaths.net/wp/2018/03/27/the-imaginal-self-the-infinitesimal-you/</em><hr/></center>",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress/1.0.1\",\"tags\":[\"awareness\",\"creation\",\"truth\",\"wisdom\"]}"
    }
  ]
}
2018/03/25 04:39:00
votershadypassion
authorearthempaths
permlinkstrange-pull-of-what-you-love
weight10000 (100.00%)
Transaction InfoBlock #20974425/Trx dee44f165b4e9365b0bb1b7b8eb80ae92ba29ff5
View Raw JSON Data
{
  "trx_id": "dee44f165b4e9365b0bb1b7b8eb80ae92ba29ff5",
  "block": 20974425,
  "trx_in_block": 21,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2018-03-25T04:39:00",
  "op": [
    "vote",
    {
      "voter": "shadypassion",
      "author": "earthempaths",
      "permlink": "strange-pull-of-what-you-love",
      "weight": 10000
    }
  ]
}

Account Metadata

POSTING JSON METADATA
profile{"profile_image":"http://earthempaths.net/forum/phpBB3/download/file.php?avatar=50_1424445185.jpg","cover_image":"http://earthempaths.net/wp/wp-content/uploads/2018/01/Reflecting-light-and-chair.jpg","name":"Earth Empaths","about":"The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.","location":"Mother Earth","website":"http://earthempaths.net/wp/"}
JSON METADATA
profile{"profile_image":"http://earthempaths.net/forum/phpBB3/download/file.php?avatar=50_1424445185.jpg","cover_image":"http://earthempaths.net/wp/wp-content/uploads/2018/01/Reflecting-light-and-chair.jpg","name":"Earth Empaths","about":"The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.","location":"Mother Earth","website":"http://earthempaths.net/wp/"}
{
  "posting_json_metadata": {
    "profile": {
      "profile_image": "http://earthempaths.net/forum/phpBB3/download/file.php?avatar=50_1424445185.jpg",
      "cover_image": "http://earthempaths.net/wp/wp-content/uploads/2018/01/Reflecting-light-and-chair.jpg",
      "name": "Earth Empaths",
      "about": "The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.",
      "location": "Mother Earth",
      "website": "http://earthempaths.net/wp/"
    }
  },
  "json_metadata": {
    "profile": {
      "profile_image": "http://earthempaths.net/forum/phpBB3/download/file.php?avatar=50_1424445185.jpg",
      "cover_image": "http://earthempaths.net/wp/wp-content/uploads/2018/01/Reflecting-light-and-chair.jpg",
      "name": "Earth Empaths",
      "about": "The impossible, the incredible, the unbelievable, the miraculous, the infinite is pulsing in our very center, we are the Genesis of Love.",
      "location": "Mother Earth",
      "website": "http://earthempaths.net/wp/"
    }
  }
}

Auth Keys

Owner
Single Signature
Public Keys
STM6zGjqzr2xWa5bRAkahE8goVCdMUwMpRSNmBdiemVfYeZEfWpPM1/1
Active
Single Signature
Public Keys
STM8mW8pm42ZxGB5ckRcug7awAFbeqCFgjYeRthX52qJXZUNcRxmG1/1
Posting
Single Signature
Public Keys
STM5dDjnwPiV39RxLd7gzXnLydTREo2EPk7a4s77BXFMB3hTp4Pd61/1
App Permissions
Memo
STM5cnNbWwqq2HxxK8TEBHXyLh32uxYv1ZSvT5uaRBvgJAZiNb13Z
{
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM6zGjqzr2xWa5bRAkahE8goVCdMUwMpRSNmBdiemVfYeZEfWpPM",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8mW8pm42ZxGB5ckRcug7awAFbeqCFgjYeRthX52qJXZUNcRxmG",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [
      [
        "dtube.app",
        1
      ]
    ],
    "key_auths": [
      [
        "STM5dDjnwPiV39RxLd7gzXnLydTREo2EPk7a4s77BXFMB3hTp4Pd6",
        1
      ]
    ]
  },
  "memo": "STM5cnNbWwqq2HxxK8TEBHXyLh32uxYv1ZSvT5uaRBvgJAZiNb13Z"
}

Witness Votes

0 / 30
No active witness votes.
[]